Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6815
Gene name
LocationContig_735:848..1696
Strand-
Gene length (bp)848
Transcript length (bp)777
Coding sequence length (bp)777
Protein length (aa) 259

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01012 ETF Electron transfer flavoprotein domain 6.5E-45 29 215

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54YZ4|ETFB_DICDI Electron transfer flavoprotein subunit beta OS=Dictyostelium discoideum GN=etfb PE=3 SV=1 3 254 9.0E-98
sp|P38117|ETFB_HUMAN Electron transfer flavoprotein subunit beta OS=Homo sapiens GN=ETFB PE=1 SV=3 1 256 1.0E-97
sp|Q2TBV3|ETFB_BOVIN Electron transfer flavoprotein subunit beta OS=Bos taurus GN=ETFB PE=1 SV=3 1 256 4.0E-97
sp|Q5RFK0|ETFB_PONAB Electron transfer flavoprotein subunit beta OS=Pongo abelii GN=ETFB PE=2 SV=3 1 256 5.0E-97
sp|Q9DCW4|ETFB_MOUSE Electron transfer flavoprotein subunit beta OS=Mus musculus GN=Etfb PE=1 SV=3 1 256 9.0E-96
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54YZ4|ETFB_DICDI Electron transfer flavoprotein subunit beta OS=Dictyostelium discoideum GN=etfb PE=3 SV=1 3 254 9.0E-98
sp|P38117|ETFB_HUMAN Electron transfer flavoprotein subunit beta OS=Homo sapiens GN=ETFB PE=1 SV=3 1 256 1.0E-97
sp|Q2TBV3|ETFB_BOVIN Electron transfer flavoprotein subunit beta OS=Bos taurus GN=ETFB PE=1 SV=3 1 256 4.0E-97
sp|Q5RFK0|ETFB_PONAB Electron transfer flavoprotein subunit beta OS=Pongo abelii GN=ETFB PE=2 SV=3 1 256 5.0E-97
sp|Q9DCW4|ETFB_MOUSE Electron transfer flavoprotein subunit beta OS=Mus musculus GN=Etfb PE=1 SV=3 1 256 9.0E-96
sp|Q68FU3|ETFB_RAT Electron transfer flavoprotein subunit beta OS=Rattus norvegicus GN=Etfb PE=2 SV=3 1 256 1.0E-95
sp|Q6UAQ8|ETFB_PIG Electron transfer flavoprotein subunit beta OS=Sus scrofa GN=ETFB PE=2 SV=3 1 256 3.0E-95
sp|P42940|ETFB_YEAST Probable electron transfer flavoprotein subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIR1 PE=1 SV=1 4 258 8.0E-87
sp|P53575|ETFB_BRADU Electron transfer flavoprotein subunit beta OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=etfB PE=3 SV=2 4 258 5.0E-85
sp|Q7F9U3|ETFB_ORYSJ Electron transfer flavoprotein subunit beta, mitochondrial OS=Oryza sativa subsp. japonica GN=ETFB PE=3 SV=1 4 253 3.0E-84
sp|Q9HZP6|ETFB_PSEAE Electron transfer flavoprotein subunit beta OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=etfB PE=3 SV=1 4 253 3.0E-84
sp|A2XQV4|ETFB_ORYSI Electron transfer flavoprotein subunit beta, mitochondrial OS=Oryza sativa subsp. indica GN=ETFB PE=3 SV=1 4 253 4.0E-84
sp|Q9LSW8|ETFB_ARATH Electron transfer flavoprotein subunit beta, mitochondrial OS=Arabidopsis thaliana GN=ETFB PE=1 SV=1 4 253 9.0E-84
sp|P38975|ETFB_PARDE Electron transfer flavoprotein subunit beta OS=Paracoccus denitrificans GN=etfB PE=1 SV=1 4 258 4.0E-82
sp|Q9UTH2|ETFB_SCHPO Probable electron transfer flavoprotein subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1805.02c PE=3 SV=1 1 258 3.0E-78
sp|P94550|ETFB_BACSU Electron transfer flavoprotein subunit beta OS=Bacillus subtilis (strain 168) GN=etfB PE=3 SV=1 4 207 1.0E-30
sp|P97089|ETFB_THETC Electron transfer flavoprotein subunit beta OS=Thermoanaerobacterium thermosaccharolyticum (strain ATCC 7956 / DSM 571 / NCIB 9385 / NCA 3814) GN=etfB PE=3 SV=1 4 208 1.0E-26
sp|P9WNG7|ETFB_MYCTU Electron transfer flavoprotein subunit beta OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=etfB PE=1 SV=1 5 246 2.0E-26
sp|P9WNG6|ETFB_MYCTO Electron transfer flavoprotein subunit beta OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=etfB PE=3 SV=1 5 246 2.0E-26
sp|P64098|ETFB_MYCBO Electron transfer flavoprotein subunit beta OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=etfB PE=1 SV=1 5 246 2.0E-26
sp|O33095|ETFB_MYCLE Electron transfer flavoprotein subunit beta OS=Mycobacterium leprae (strain TN) GN=etfB PE=3 SV=1 5 246 1.0E-24
sp|O85691|ETFB_MEGEL Electron transfer flavoprotein subunit beta OS=Megasphaera elsdenii GN=etfB PE=3 SV=1 4 244 7.0E-24
sp|P53570|ETFB_METME Electron transfer flavoprotein subunit beta OS=Methylophilus methylotrophus GN=etfB PE=1 SV=1 4 219 1.0E-21
sp|P52040|ETFB_CLOAB Electron transfer flavoprotein subunit beta OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=etfB PE=3 SV=2 4 219 8.0E-19
sp|P53576|FIXA_AZOVI Protein FixA OS=Azotobacter vinelandii GN=fixA PE=3 SV=1 7 242 1.0E-17
sp|G3KIM7|ETFB_CLOPR Acryloyl-CoA reductase electron transfer subunit gamma OS=Clostridium propionicum GN=acrB PE=1 SV=1 4 217 1.0E-17
sp|Q53210|FIXA_RHISN Protein FixA OS=Rhizobium sp. (strain NGR234) GN=fixA PE=3 SV=1 4 240 3.0E-16
sp|P53577|FIXA_BRADU Protein FixA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=fixA PE=3 SV=2 7 221 2.0E-15
sp|P26482|FIXA_AZOC5 Protein FixA OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=fixA PE=3 SV=1 4 221 2.0E-14
sp|Q05559|FIXA_RHILP Protein FixA OS=Rhizobium leguminosarum bv. phaseoli GN=fixA PE=3 SV=1 4 236 9.0E-14
sp|P09818|FIXA_RHIME Protein FixA OS=Rhizobium meliloti (strain 1021) GN=fixA PE=3 SV=1 4 209 5.0E-13
sp|Q46908|YGCR_ECOLI Putative electron transfer flavoprotein subunit YgcR OS=Escherichia coli (strain K12) GN=ygcR PE=3 SV=2 56 184 1.0E-09
sp|Q8FLA3|FIXA_ECOL6 Protein FixA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fixA PE=3 SV=2 22 237 2.0E-08
sp|B7MAG4|FIXA_ECO45 Protein FixA OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=fixA PE=3 SV=1 22 237 2.0E-08
sp|B7UI87|FIXA_ECO27 Protein FixA OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=fixA PE=3 SV=1 22 237 2.0E-08
sp|Q0TLU8|FIXA_ECOL5 Protein FixA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=fixA PE=3 SV=1 22 237 3.0E-08
sp|B7MNP8|FIXA_ECO81 Protein FixA OS=Escherichia coli O81 (strain ED1a) GN=fixA PE=3 SV=1 22 237 3.0E-08
sp|B1LFX5|FIXA_ECOSM Protein FixA OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=fixA PE=3 SV=1 22 237 5.0E-06
sp|B7NHE5|FIXA_ECO7I Protein FixA OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=fixA PE=3 SV=1 22 237 5.0E-06
sp|B7N7R6|FIXA_ECOLU Protein FixA OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=fixA PE=3 SV=1 120 237 7.0E-06
sp|P60566|FIXA_ECOLI Protein FixA OS=Escherichia coli (strain K12) GN=fixA PE=1 SV=1 120 237 8.0E-06
sp|B1IRD5|FIXA_ECOLC Protein FixA OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=fixA PE=3 SV=1 120 237 8.0E-06
sp|A7ZVZ3|FIXA_ECOHS Protein FixA OS=Escherichia coli O9:H4 (strain HS) GN=fixA PE=3 SV=1 120 237 8.0E-06
sp|B1XBG6|FIXA_ECODH Protein FixA OS=Escherichia coli (strain K12 / DH10B) GN=fixA PE=3 SV=1 120 237 8.0E-06
sp|C4ZPW7|FIXA_ECOBW Protein FixA OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=fixA PE=3 SV=1 120 237 8.0E-06
sp|P60567|FIXA_ECO57 Protein FixA OS=Escherichia coli O157:H7 GN=fixA PE=3 SV=1 120 237 8.0E-06
sp|A7ZHD4|FIXA_ECO24 Protein FixA OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=fixA PE=3 SV=1 120 237 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6815
MSSLRILVPIKRVIDYAVKPRVNKARTGVETAGVKHSMNPFDELSVEEAVRIREKKRAPGGVEDICAISAGPAKA
VDVLRTAMAMGADRGIHVEVPEGQELEPLTVAKMLRVAVEQQKSNLVVLGKQSIDDDAGQTGQMLAGLLDWPQAT
QASKVEFGQGDSVTVTREVDGGVETIRARLPMVVTTDLRLNEPRYANLPNIMKAKRKKLDTTTLEALGIKNERRL
KVLRVEEPPPRQGGAKVEDVGGLVSRLKELGAL*
Coding >OphauG2|6815
ATGTCTTCGCTTCGCATTCTCGTCCCCATCAAGCGGGTAATTGACTATGCTGTCAAGCCACGGGTCAACAAGGCG
AGGACAGGAGTGGAAACAGCCGGGGTGAAGCACTCAATGAATCCCTTTGACGAGCTGTCGGTGGAGGAGGCGGTT
CGGATCCGGGAGAAGAAGCGGGCTCCGGGAGGAGTGGAGGACATCTGTGCCATCTCGGCAGGACCGGCCAAGGCG
GTGGATGTGCTGCGGACGGCCATGGCCATGGGGGCGGACCGAGGCATTCACGTCGAGGTGCCCGAGGGCCAAGAG
CTGGAGCCATTGACCGTGGCCAAAATGCTACGGGTGGCGGTGGAGCAGCAAAAGAGCAATCTGGTGGTGCTGGGC
AAGCAGAGCATCGACGACGATGCGGGCCAGACGGGCCAGATGCTGGCGGGGCTGTTGGACTGGCCGCAGGCAACA
CAAGCAAGCAAGGTGGAGTTTGGCCAAGGGGACAGCGTGACGGTGACGCGCGAGGTGGATGGGGGCGTTGAGACG
ATACGGGCGCGGCTTCCCATGGTGGTGACGACGGACCTGCGTCTCAACGAGCCGCGCTACGCCAACCTGCCCAAC
ATTATGAAGGCCAAGAGGAAGAAGCTGGACACGACGACTCTGGAGGCGCTGGGGATTAAGAATGAGCGGCGGCTC
AAGGTGCTCAGGGTGGAGGAGCCGCCGCCGCGGCAGGGAGGAGCAAAGGTGGAAGACGTGGGGGGGCTGGTGAGC
AGGCTCAAGGAGCTCGGGGCGCTGTAG
Transcript >OphauG2|6815
ATGTCTTCGCTTCGCATTCTCGTCCCCATCAAGCGGGTAATTGACTATGCTGTCAAGCCACGGGTCAACAAGGCG
AGGACAGGAGTGGAAACAGCCGGGGTGAAGCACTCAATGAATCCCTTTGACGAGCTGTCGGTGGAGGAGGCGGTT
CGGATCCGGGAGAAGAAGCGGGCTCCGGGAGGAGTGGAGGACATCTGTGCCATCTCGGCAGGACCGGCCAAGGCG
GTGGATGTGCTGCGGACGGCCATGGCCATGGGGGCGGACCGAGGCATTCACGTCGAGGTGCCCGAGGGCCAAGAG
CTGGAGCCATTGACCGTGGCCAAAATGCTACGGGTGGCGGTGGAGCAGCAAAAGAGCAATCTGGTGGTGCTGGGC
AAGCAGAGCATCGACGACGATGCGGGCCAGACGGGCCAGATGCTGGCGGGGCTGTTGGACTGGCCGCAGGCAACA
CAAGCAAGCAAGGTGGAGTTTGGCCAAGGGGACAGCGTGACGGTGACGCGCGAGGTGGATGGGGGCGTTGAGACG
ATACGGGCGCGGCTTCCCATGGTGGTGACGACGGACCTGCGTCTCAACGAGCCGCGCTACGCCAACCTGCCCAAC
ATTATGAAGGCCAAGAGGAAGAAGCTGGACACGACGACTCTGGAGGCGCTGGGGATTAAGAATGAGCGGCGGCTC
AAGGTGCTCAGGGTGGAGGAGCCGCCGCCGCGGCAGGGAGGAGCAAAGGTGGAAGACGTGGGGGGGCTGGTGAGC
AGGCTCAAGGAGCTCGGGGCGCTGTAG
Gene >OphauG2|6815
ATGTCTTCGCTTCGCATTCTCGTCCCCATCAAGCGGGTAATTGACTATGCTGTAGGTGCTGGGGGACAATGGCGC
AGCAGAGTGAGAGCAATGGGGACACTGACATGGACGCTGGACTGCAGGTCAAGCCACGGGTCAACAAGGCGAGGA
CAGGAGTGGAAACAGCCGGGGTGAAGCACTCAATGAATCCCTTTGACGAGCTGTCGGTGGAGGAGGCGGTTCGGA
TCCGGGAGAAGAAGCGGGCTCCGGGAGGAGTGGAGGACATCTGTGCCATCTCGGCAGGACCGGCCAAGGCGGTGG
ATGTGCTGCGGACGGCCATGGCCATGGGGGCGGACCGAGGCATTCACGTCGAGGTGCCCGAGGGCCAAGAGCTGG
AGCCATTGACCGTGGCCAAAATGCTACGGGTGGCGGTGGAGCAGCAAAAGAGCAATCTGGTGGTGCTGGGCAAGC
AGAGCATCGACGACGATGCGGGCCAGACGGGCCAGATGCTGGCGGGGCTGTTGGACTGGCCGCAGGCAACACAAG
CAAGCAAGGTGGAGTTTGGCCAAGGGGACAGCGTGACGGTGACGCGCGAGGTGGATGGGGGCGTTGAGACGATAC
GGGCGCGGCTTCCCATGGTGGTGACGACGGACCTGCGTCTCAACGAGCCGCGCTACGCCAACCTGCCCAACATTA
TGAAGGCCAAGAGGAAGAAGCTGGACACGACGACTCTGGAGGCGCTGGGGATTAAGAATGAGCGGCGGCTCAAGG
TGCTCAGGGTGGAGGAGCCGCCGCCGCGGCAGGGAGGAGCAAAGGTGGAAGACGTGGGGGGGCTGGTGAGCAGGC
TCAAGGAGCTCGGGGCGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail