Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6776
Gene name
LocationContig_727:489..3011
Strand+
Gene length (bp)2522
Transcript length (bp)2454
Coding sequence length (bp)2454
Protein length (aa) 818

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12325 TMF_TATA_bd TATA element modulatory factor 1 TATA binding 2.4E-40 701 814
PF12329 TMF_DNA_bd TATA element modulatory factor 1 DNA binding 1.5E-18 223 295

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P82094|TMF1_HUMAN TATA element modulatory factor OS=Homo sapiens GN=TMF1 PE=1 SV=2 189 809 9.0E-19
sp|Q9Y7Y1|SGM1_SCHPO Protein sgm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sgm1 PE=3 SV=1 351 808 5.0E-12
sp|P47166|SGM1_YEAST Protein SGM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGM1 PE=1 SV=1 228 807 7.0E-10
sp|B9EKI3|TMF1_MOUSE TATA element modulatory factor OS=Mus musculus GN=Tmf1 PE=1 SV=2 714 809 9.0E-10
sp|B9EKI3|TMF1_MOUSE TATA element modulatory factor OS=Mus musculus GN=Tmf1 PE=1 SV=2 189 473 2.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6776
MAAPGKQSRWGSLLSQAVAGVESRLDNMLTESDHGPGQTQRPQSPSARAAQTKPSSANSRSSSTSRGGDRLQARL
AKAVVGKTPAGGVDGKTLASPRSSTDQASRAPADGSPAERDGKPVDAVAPDSDDATSLPCTTRDSPALEPLEASA
PPAQVLQEQEATAHQQVQQSVPPQDVEELKKLQQQEVQEYVERIDSLQSKLQYLSSNAAEAAKKTAASAPLGSTE
RKLAEKDEKIALLMHEGQKLSGTEQKLRLTIKRLRQQMTEHDKQSDQVRKSRDKATAEIESLRQRLDGAQGSDRQ
QEAARRSATALHKELDLLRREVGEKDRAHRQLEQEFRVKTEEVNAAGADALRKALAAEREKQKELEDSNAVLVAQ
TQSLMASARQENIEWQEKLQRSVERARNVEDELRLELQSMERKLESMRMAVEEASSGTGGEAQVKMFRQLETLQC
QYASSRENWRGMESSLLGKAASLERERDEAHRRESEMRKKAREAATRSRLLEDELHDAKTGLASAREELESCRHQ
LSSLQTSSATMQETLEQTRAELDKQRQAAARTREPSTGDSSRDEVMEAERRKWVDDVAGATSKGHDSRPDSPMLS
VTRTLSSDLASLAVPGRSRRVATPASIPDSQGDMMALSMRRLSSQAQMRIGGVSTAPAPFSPFDVPPESPLIPSP
PTGDRDSAVDETAPSSPRNLTHDMISVSTVAAGPSVQLVERMSAAIRRLEADKVAAKEEMARVCNQRDEARSDMV
GLMKHLEEAKTAAGRLPQLEAQVADLDARYQTTLEMLGEKSELVEELRADVDDVKAMYRELVERTVT*
Coding >OphauG2|6776
ATGGCTGCACCGGGCAAACAGTCGCGATGGGGCTCGCTGCTCTCGCAGGCTGTTGCCGGCGTCGAGTCTCGCCTC
GACAACATGCTGACCGAGTCGGACCATGGGCCGGGGCAGACCCAACGCCCCCAAAGCCCCTCGGCCCGCGCGGCG
CAGACAAAGCCCAGCTCGGCCAATTCGCGCTCGTCGTCAACCAGCCGTGGCGGCGACCGGCTCCAGGCGAGGCTG
GCCAAGGCGGTTGTTGGCAAGACGCCAGCAGGAGGAGTCGACGGCAAGACTTTGGCGTCACCGCGCAGCTCCACG
GACCAGGCAAGCCGAGCGCCTGCTGACGGGTCCCCGGCGGAACGGGATGGCAAGCCCGTCGATGCAGTGGCCCCA
GACTCTGACGACGCGACAAGCTTGCCTTGCACCACAAGAGACAGTCCCGCATTAGAGCCCCTTGAGGCCAGCGCG
CCGCCAGCCCAAGTGCTCCAGGAGCAAGAGGCCACTGCCCATCAACAGGTCCAACAGTCTGTCCCGCCTCAGGAT
GTAGAGGAGCTCAAGAAGCTGCAGCAACAAGAGGTGCAAGAATACGTGGAACGAATAGACTCGCTCCAATCCAAG
CTCCAATATCTATCCAGCAATGCCGCCGAAGCGGCCAAAAAGACTGCAGCATCCGCTCCGCTTGGCAGTACGGAG
CGCAAACTGGCTGAAAAGGATGAAAAGATAGCGCTGCTAATGCACGAGGGTCAAAAGCTGTCGGGTACAGAACAA
AAACTCCGCTTAACCATCAAGAGGCTGCGGCAGCAAATGACGGAACACGACAAACAAAGTGATCAAGTTCGAAAG
AGCAGAGACAAGGCCACTGCCGAGATTGAGTCTCTGCGCCAACGCTTGGATGGCGCCCAAGGGAGCGATAGGCAA
CAAGAGGCAGCCAGACGGTCCGCGACGGCTCTGCACAAAGAGCTGGATTTGCTCAGGAGGGAAGTGGGGGAAAAG
GACAGGGCTCATCGTCAGCTCGAGCAAGAGTTCAGGGTCAAGACTGAAGAGGTCAATGCCGCTGGTGCTGATGCG
CTCCGCAAAGCTCTTGCGGCCGAGAGAGAGAAGCAAAAGGAGCTTGAAGATTCAAATGCTGTGCTTGTTGCACAA
ACCCAGTCATTGATGGCTTCAGCACGCCAGGAGAATATTGAATGGCAGGAAAAACTGCAGCGTAGTGTCGAGCGG
GCACGCAATGTCGAGGATGAGTTACGTCTCGAGCTACAGTCAATGGAGAGAAAGCTCGAGTCGATGAGAATGGCA
GTGGAAGAAGCGTCTTCGGGTACAGGAGGCGAGGCCCAAGTCAAAATGTTTCGCCAGCTCGAGACGCTACAATGC
CAATATGCCTCATCACGCGAGAACTGGCGAGGGATGGAGTCGTCTTTGCTTGGAAAAGCAGCCAGCCTCGAAAGG
GAGAGGGATGAGGCGCACCGACGAGAGTCGGAGATGCGCAAGAAGGCGCGTGAAGCGGCAACCCGCAGCCGCCTG
CTCGAGGATGAGCTTCACGACGCAAAGACGGGGCTTGCGTCGGCACGGGAGGAGCTCGAATCATGTCGCCACCAG
CTGTCCTCTCTGCAGACATCATCCGCCACCATGCAAGAGACTCTGGAGCAGACACGGGCTGAGCTCGACAAGCAG
AGACAAGCTGCGGCACGGACTAGAGAGCCGAGTACAGGGGATTCGAGCAGAGACGAAGTGATGGAGGCGGAGCGA
CGCAAATGGGTCGACGATGTAGCGGGAGCCACCTCCAAGGGCCACGACAGCAGGCCAGACTCGCCCATGCTGTCG
GTAACGCGTACCTTGAGCTCCGACTTGGCTAGTCTGGCAGTGCCGGGGCGATCGCGGCGCGTGGCTACTCCTGCC
AGCATCCCAGACAGCCAGGGCGACATGATGGCGCTTTCGATGCGGCGTCTATCGAGCCAGGCGCAGATGCGGATA
GGCGGAGTGTCAACGGCGCCAGCTCCCTTTTCGCCGTTTGATGTGCCGCCAGAGTCTCCGCTGATTCCGTCGCCG
CCGACTGGAGATCGAGATAGTGCCGTGGACGAGACGGCCCCATCGTCGCCTCGCAATCTGACGCACGACATGATT
TCCGTCTCGACCGTGGCCGCCGGGCCGTCGGTGCAGCTCGTGGAGCGCATGAGCGCGGCCATTCGGCGCCTAGAA
GCAGACAAGGTGGCTGCAAAGGAGGAAATGGCGCGCGTTTGCAACCAGAGAGACGAGGCGCGATCCGACATGGTT
GGTCTCATGAAGCATCTCGAGGAGGCCAAGACGGCTGCTGGCAGGCTGCCGCAGCTTGAGGCCCAGGTGGCGGAC
CTTGACGCGAGATACCAGACGACGCTTGAGATGCTGGGCGAGAAGAGCGAGCTCGTTGAGGAGCTGCGGGCTGAT
GTCGACGATGTCAAGGCCATGTACCGCGAGCTGGTTGAGCGGACCGTGACTTGA
Transcript >OphauG2|6776
ATGGCTGCACCGGGCAAACAGTCGCGATGGGGCTCGCTGCTCTCGCAGGCTGTTGCCGGCGTCGAGTCTCGCCTC
GACAACATGCTGACCGAGTCGGACCATGGGCCGGGGCAGACCCAACGCCCCCAAAGCCCCTCGGCCCGCGCGGCG
CAGACAAAGCCCAGCTCGGCCAATTCGCGCTCGTCGTCAACCAGCCGTGGCGGCGACCGGCTCCAGGCGAGGCTG
GCCAAGGCGGTTGTTGGCAAGACGCCAGCAGGAGGAGTCGACGGCAAGACTTTGGCGTCACCGCGCAGCTCCACG
GACCAGGCAAGCCGAGCGCCTGCTGACGGGTCCCCGGCGGAACGGGATGGCAAGCCCGTCGATGCAGTGGCCCCA
GACTCTGACGACGCGACAAGCTTGCCTTGCACCACAAGAGACAGTCCCGCATTAGAGCCCCTTGAGGCCAGCGCG
CCGCCAGCCCAAGTGCTCCAGGAGCAAGAGGCCACTGCCCATCAACAGGTCCAACAGTCTGTCCCGCCTCAGGAT
GTAGAGGAGCTCAAGAAGCTGCAGCAACAAGAGGTGCAAGAATACGTGGAACGAATAGACTCGCTCCAATCCAAG
CTCCAATATCTATCCAGCAATGCCGCCGAAGCGGCCAAAAAGACTGCAGCATCCGCTCCGCTTGGCAGTACGGAG
CGCAAACTGGCTGAAAAGGATGAAAAGATAGCGCTGCTAATGCACGAGGGTCAAAAGCTGTCGGGTACAGAACAA
AAACTCCGCTTAACCATCAAGAGGCTGCGGCAGCAAATGACGGAACACGACAAACAAAGTGATCAAGTTCGAAAG
AGCAGAGACAAGGCCACTGCCGAGATTGAGTCTCTGCGCCAACGCTTGGATGGCGCCCAAGGGAGCGATAGGCAA
CAAGAGGCAGCCAGACGGTCCGCGACGGCTCTGCACAAAGAGCTGGATTTGCTCAGGAGGGAAGTGGGGGAAAAG
GACAGGGCTCATCGTCAGCTCGAGCAAGAGTTCAGGGTCAAGACTGAAGAGGTCAATGCCGCTGGTGCTGATGCG
CTCCGCAAAGCTCTTGCGGCCGAGAGAGAGAAGCAAAAGGAGCTTGAAGATTCAAATGCTGTGCTTGTTGCACAA
ACCCAGTCATTGATGGCTTCAGCACGCCAGGAGAATATTGAATGGCAGGAAAAACTGCAGCGTAGTGTCGAGCGG
GCACGCAATGTCGAGGATGAGTTACGTCTCGAGCTACAGTCAATGGAGAGAAAGCTCGAGTCGATGAGAATGGCA
GTGGAAGAAGCGTCTTCGGGTACAGGAGGCGAGGCCCAAGTCAAAATGTTTCGCCAGCTCGAGACGCTACAATGC
CAATATGCCTCATCACGCGAGAACTGGCGAGGGATGGAGTCGTCTTTGCTTGGAAAAGCAGCCAGCCTCGAAAGG
GAGAGGGATGAGGCGCACCGACGAGAGTCGGAGATGCGCAAGAAGGCGCGTGAAGCGGCAACCCGCAGCCGCCTG
CTCGAGGATGAGCTTCACGACGCAAAGACGGGGCTTGCGTCGGCACGGGAGGAGCTCGAATCATGTCGCCACCAG
CTGTCCTCTCTGCAGACATCATCCGCCACCATGCAAGAGACTCTGGAGCAGACACGGGCTGAGCTCGACAAGCAG
AGACAAGCTGCGGCACGGACTAGAGAGCCGAGTACAGGGGATTCGAGCAGAGACGAAGTGATGGAGGCGGAGCGA
CGCAAATGGGTCGACGATGTAGCGGGAGCCACCTCCAAGGGCCACGACAGCAGGCCAGACTCGCCCATGCTGTCG
GTAACGCGTACCTTGAGCTCCGACTTGGCTAGTCTGGCAGTGCCGGGGCGATCGCGGCGCGTGGCTACTCCTGCC
AGCATCCCAGACAGCCAGGGCGACATGATGGCGCTTTCGATGCGGCGTCTATCGAGCCAGGCGCAGATGCGGATA
GGCGGAGTGTCAACGGCGCCAGCTCCCTTTTCGCCGTTTGATGTGCCGCCAGAGTCTCCGCTGATTCCGTCGCCG
CCGACTGGAGATCGAGATAGTGCCGTGGACGAGACGGCCCCATCGTCGCCTCGCAATCTGACGCACGACATGATT
TCCGTCTCGACCGTGGCCGCCGGGCCGTCGGTGCAGCTCGTGGAGCGCATGAGCGCGGCCATTCGGCGCCTAGAA
GCAGACAAGGTGGCTGCAAAGGAGGAAATGGCGCGCGTTTGCAACCAGAGAGACGAGGCGCGATCCGACATGGTT
GGTCTCATGAAGCATCTCGAGGAGGCCAAGACGGCTGCTGGCAGGCTGCCGCAGCTTGAGGCCCAGGTGGCGGAC
CTTGACGCGAGATACCAGACGACGCTTGAGATGCTGGGCGAGAAGAGCGAGCTCGTTGAGGAGCTGCGGGCTGAT
GTCGACGATGTCAAGGCCATGTACCGCGAGCTGGTTGAGCGGACCGTGACTTGA
Gene >OphauG2|6776
ATGGCTGCACCGGGCAAACAGTCGCGATGGGGCTCGCTGCTCTCGCAGGCTGTTGCCGGCGTCGAGTCTCGCCTC
GACAACATGCTGACCGAGTCGGACCATGGGCCGGGGCAGACCCAACGCCCCCAAAGCCCCTCGGCCCGCGCGGCG
CAGACAAAGCCCAGCTCGGCCAATTCGCGCTCGTCGTCAACCAGCCGTGGCGGCGACCGGCTCCAGGCGAGGCTG
GCCAAGGCGGTTGTTGGCAAGACGCCAGCAGGAGGAGTCGACGGCAAGACTTTGGCGTCACCGCGCAGCTCCACG
GACCAGGCAAGCCGAGCGCCTGCTGACGGGTCCCCGGCGGAACGGGATGGCAAGCCCGTCGATGCAGTGGCCCCA
GACTCTGACGACGCGACAAGCTTGCCTTGCACCACAAGAGACAGTCCCGCATTAGAGCCCCTTGAGGCCAGCGCG
CCGCCAGCCCAAGTGCTCCAGGAGCAAGAGGCCACTGCCCATCAACAGGTCCAACAGTCTGTCCCGCCTCAGGAT
GTAGAGGAGCTCAAGAAGCTGCAGCAACAAGAGGTGCAAGAATACGTGGAACGAATAGACTCGCTCCAATCCAAG
CTCCAATATCTATCCAGCAATGCCGCCGAAGCGGCCAAAAAGACTGCAGCATCCGCTCCGCTTGGCAGTACGGAG
CGCAAACTGGCTGAAAAGGATGAAAAGATAGCGCTGCTAATGCACGAGGGTCAAAAGCTGTCGGGTACAGAACAA
AAACTCCGCTTAACCATCAAGAGGCTGCGGCAGCAAATGACGGAACACGACAAACAAAGTGATCAAGTTCGAAAG
AGCAGAGACAAGGCCACTGCCGAGATTGAGTCTCTGCGCCAACGCTTGGATGGCGCCCAAGGGAGCGATAGGCAA
CAAGAGGCAGCCAGACGGTCCGCGACGGCTCTGCACAAAGAGCTGGATTTGCTCAGGAGGGAAGTGGGGGAAAAG
GACAGGGCTCATCGTCAGCTCGAGCAAGAGTTCAGGGTCAAGACTGAAGAGGTCAATGCCGCTGGTGCTGATGCG
CTCCGCAAAGCTCTTGCGGCCGAGAGAGAGAAGCAAAAGGAGCTTGAAGATTCAAATGCTGTGCTTGTTGCACAA
ACCCAGTCATTGATGGCTTCAGCACGCCAGGAGAATATTGAATGGCAGGAAAAACTGCAGCGTAGTGTCGAGCGG
GCACGCAATGTCGAGGATGAGTTACGTCTCGAGCTACAGTCAATGGAGAGAAAGCTCGAGTCGATGAGAATGGCA
GTGGAAGAAGCGTCTTCGGGTACAGGAGGCGAGGCCCAAGTCAAAATGTTTCGCCAGCTCGAGACGCTACAATGC
CAATATGCCTCATCACGCGAGAACTGGCGAGGGATGGAGTCGTCTTTGCTTGGAAAAGCAGCCAGCCTCGAAAGG
GAGAGGGATGAGGCGCACCGACGAGAGTCGGAGATGCGCAAGAAGGCGCGTGAAGCGGTAAGTCGGCCATGCAGC
CCCATGTAGCATCAAGCAAAGAGGTTCTCACAGTTGCTCGCATCTGGCAGGCAACCCGCAGCCGCCTGCTCGAGG
ATGAGCTTCACGACGCAAAGACGGGGCTTGCGTCGGCACGGGAGGAGCTCGAATCATGTCGCCACCAGCTGTCCT
CTCTGCAGACATCATCCGCCACCATGCAAGAGACTCTGGAGCAGACACGGGCTGAGCTCGACAAGCAGAGACAAG
CTGCGGCACGGACTAGAGAGCCGAGTACAGGGGATTCGAGCAGAGACGAAGTGATGGAGGCGGAGCGACGCAAAT
GGGTCGACGATGTAGCGGGAGCCACCTCCAAGGGCCACGACAGCAGGCCAGACTCGCCCATGCTGTCGGTAACGC
GTACCTTGAGCTCCGACTTGGCTAGTCTGGCAGTGCCGGGGCGATCGCGGCGCGTGGCTACTCCTGCCAGCATCC
CAGACAGCCAGGGCGACATGATGGCGCTTTCGATGCGGCGTCTATCGAGCCAGGCGCAGATGCGGATAGGCGGAG
TGTCAACGGCGCCAGCTCCCTTTTCGCCGTTTGATGTGCCGCCAGAGTCTCCGCTGATTCCGTCGCCGCCGACTG
GAGATCGAGATAGTGCCGTGGACGAGACGGCCCCATCGTCGCCTCGCAATCTGACGCACGACATGATTTCCGTCT
CGACCGTGGCCGCCGGGCCGTCGGTGCAGCTCGTGGAGCGCATGAGCGCGGCCATTCGGCGCCTAGAAGCAGACA
AGGTGGCTGCAAAGGAGGAAATGGCGCGCGTTTGCAACCAGAGAGACGAGGCGCGATCCGACATGGTTGGTCTCA
TGAAGCATCTCGAGGAGGCCAAGACGGCTGCTGGCAGGCTGCCGCAGCTTGAGGCCCAGGTGGCGGACCTTGACG
CGAGATACCAGACGACGCTTGAGATGCTGGGCGAGAAGAGCGAGCTCGTTGAGGAGCTGCGGGCTGATGTCGACG
ATGTCAAGGCCATGTACCGCGAGCTGGTTGAGCGGACCGTGACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail