Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6774
Gene name
LocationContig_726:6226..7615
Strand+
Gene length (bp)1389
Transcript length (bp)1389
Coding sequence length (bp)1389
Protein length (aa) 463

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12998 ING Inhibitor of growth proteins N-terminal histone-binding 1.2E-20 26 129

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AHB8|YNG2_CANAL Chromatin modification-related protein YNG2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YNG2 PE=3 SV=2 401 457 6.0E-20
sp|Q9QXV3|ING1_MOUSE Inhibitor of growth protein 1 OS=Mus musculus GN=Ing1 PE=2 SV=1 408 462 6.0E-20
sp|Q66KD5|ING3_XENTR Inhibitor of growth protein 3 OS=Xenopus tropicalis GN=ing3 PE=2 SV=1 407 462 1.0E-19
sp|Q8C0D7|ING4_MOUSE Inhibitor of growth protein 4 OS=Mus musculus GN=Ing4 PE=1 SV=2 408 459 1.0E-19
sp|Q9UNL4|ING4_HUMAN Inhibitor of growth protein 4 OS=Homo sapiens GN=ING4 PE=1 SV=1 408 459 2.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AHB8|YNG2_CANAL Chromatin modification-related protein YNG2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YNG2 PE=3 SV=2 401 457 6.0E-20
sp|Q9QXV3|ING1_MOUSE Inhibitor of growth protein 1 OS=Mus musculus GN=Ing1 PE=2 SV=1 408 462 6.0E-20
sp|Q66KD5|ING3_XENTR Inhibitor of growth protein 3 OS=Xenopus tropicalis GN=ing3 PE=2 SV=1 407 462 1.0E-19
sp|Q8C0D7|ING4_MOUSE Inhibitor of growth protein 4 OS=Mus musculus GN=Ing4 PE=1 SV=2 408 459 1.0E-19
sp|Q9UNL4|ING4_HUMAN Inhibitor of growth protein 4 OS=Homo sapiens GN=ING4 PE=1 SV=1 408 459 2.0E-19
sp|Q5ZKY4|ING4_CHICK Inhibitor of growth protein 4 OS=Gallus gallus GN=ING4 PE=2 SV=1 408 459 2.0E-19
sp|Q6BNL6|YNG2_DEBHA Chromatin modification-related protein YNG2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=YNG2 PE=3 SV=1 401 457 2.0E-19
sp|P38806|YNG2_YEAST Chromatin modification-related protein YNG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNG2 PE=1 SV=1 399 462 2.0E-19
sp|Q9D8Y8|ING5_MOUSE Inhibitor of growth protein 5 OS=Mus musculus GN=Ing5 PE=1 SV=1 408 459 3.0E-19
sp|Q8VEK6|ING3_MOUSE Inhibitor of growth protein 3 OS=Mus musculus GN=Ing3 PE=1 SV=2 407 462 4.0E-19
sp|Q498T3|ING3_RAT Inhibitor of growth protein 3 OS=Rattus norvegicus GN=Ing3 PE=2 SV=1 407 462 5.0E-19
sp|Q8WYH8|ING5_HUMAN Inhibitor of growth protein 5 OS=Homo sapiens GN=ING5 PE=1 SV=1 408 459 5.0E-19
sp|Q6C5V7|YNG2_YARLI Chromatin modification-related protein YNG2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YNG2 PE=3 SV=1 269 453 5.0E-19
sp|Q9LIQ6|ING1_ARATH PHD finger protein ING1 OS=Arabidopsis thaliana GN=ING1 PE=1 SV=1 408 453 5.0E-19
sp|Q6FSB1|YNG2_CANGA Chromatin modification-related protein YNG2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=YNG2 PE=3 SV=1 398 456 7.0E-19
sp|Q757W2|YNG2_ASHGO Chromatin modification-related protein YNG2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YNG2 PE=3 SV=1 384 456 1.0E-18
sp|Q9H160|ING2_HUMAN Inhibitor of growth protein 2 OS=Homo sapiens GN=ING2 PE=1 SV=2 408 462 3.0E-18
sp|Q9UK53|ING1_HUMAN Inhibitor of growth protein 1 OS=Homo sapiens GN=ING1 PE=1 SV=2 404 462 3.0E-18
sp|Q9ESK4|ING2_MOUSE Inhibitor of growth protein 2 OS=Mus musculus GN=Ing2 PE=1 SV=3 408 462 4.0E-18
sp|Q6CXN0|YNG2_KLULA Chromatin modification-related protein YNG2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YNG2 PE=3 SV=1 401 452 5.0E-18
sp|Q3T095|ING4_BOVIN Inhibitor of growth protein 4 OS=Bos taurus GN=ING4 PE=2 SV=1 408 459 1.0E-17
sp|Q08465|YNG1_YEAST Protein YNG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNG1 PE=1 SV=1 398 462 2.0E-17
sp|O42871|ING1_SCHPO Chromatin modification-related protein png1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=png1 PE=3 SV=1 398 452 4.0E-17
sp|P50947|PHO23_YEAST Transcriptional regulatory protein PHO23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO23 PE=1 SV=1 408 456 2.0E-16
sp|Q6FSB1|YNG2_CANGA Chromatin modification-related protein YNG2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=YNG2 PE=3 SV=1 21 217 2.0E-15
sp|Q6C5V7|YNG2_YARLI Chromatin modification-related protein YNG2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YNG2 PE=3 SV=1 21 181 3.0E-15
sp|O74736|ING2_SCHPO Chromatin modification-related protein png2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=png2 PE=1 SV=1 405 452 7.0E-15
sp|B3H615|ING2_ARATH PHD finger protein ING2 OS=Arabidopsis thaliana GN=ING2 PE=1 SV=1 408 452 2.0E-14
sp|O42871|ING1_SCHPO Chromatin modification-related protein png1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=png1 PE=3 SV=1 21 144 3.0E-14
sp|Q5AHB8|YNG2_CANAL Chromatin modification-related protein YNG2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YNG2 PE=3 SV=2 21 177 2.0E-13
sp|Q6BNL6|YNG2_DEBHA Chromatin modification-related protein YNG2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=YNG2 PE=3 SV=1 21 130 2.0E-09
sp|Q757W2|YNG2_ASHGO Chromatin modification-related protein YNG2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YNG2 PE=3 SV=1 20 134 2.0E-08
sp|P38806|YNG2_YEAST Chromatin modification-related protein YNG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNG2 PE=1 SV=1 21 134 5.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4122
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6774 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5562
Ophiocordyceps camponoti-floridani Ophcf2|04720
Ophiocordyceps camponoti-rufipedis Ophun1|7113
Ophiocordyceps kimflemingae Ophio5|237
Ophiocordyceps subramaniannii Hirsu2|8350

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6774
MPRDDLTIDFVKKMPAVDSHDPAIIIDDWFNRVQNLPEEIRFMQDEIADKDRQYNELIRGIEERDFKLQRWIKTN
GSHVPNPKEDILCAEIRQNYAAAEQLSAEKIALTERLRAIYDKHLRNLDAQIKHLHDRGEPGFTDPDELPSLLRN
SAANRTEPLIRTPVAAPASTSITAAGPGPSPLNPSHASASTVTAAPRPAAHPNVRQTQQSQQTQGSHAISAPATP
AATIILNRQREGSVGPSLKRIPRSTAASGNVPAASSSLGRHSSLGPGTPKGSTGAAGGAASRAGSAGPRTGSVKI
ASNATSRRGTPAAAGRKKVANKSNLSRVRKVSTRASPTSTGDSDLSEAQSTSANDDDDDDDEGNDVGSVQESASR
SKGMLTAYVRDADGDMVVGDAEDDDEGSDDKKYCLCHNVSYGDMVACDNDDCPYEWFHWSCVGLESEPNGTWYCP
ECAKKLDKKSSK*
Coding >OphauG2|6774
ATGCCTAGAGACGACTTAACCATCGACTTTGTCAAAAAGATGCCAGCGGTTGATTCACACGATCCAGCCATCATT
ATTGATGACTGGTTCAACCGCGTCCAGAACCTGCCCGAAGAGATTCGCTTTATGCAAGACGAGATCGCCGACAAG
GATCGCCAGTATAACGAACTGATTCGTGGCATTGAGGAGCGCGACTTCAAACTGCAAAGATGGATCAAGACCAAC
GGCAGCCATGTACCCAACCCTAAGGAGGATATACTATGTGCCGAAATCCGTCAGAACTATGCTGCCGCTGAACAA
CTATCTGCGGAAAAAATCGCTCTGACCGAAAGGCTACGTGCCATCTATGACAAGCACTTGCGTAACCTGGATGCC
CAGATTAAACACCTACACGATCGCGGAGAACCCGGCTTCACAGATCCCGATGAATTACCCTCCCTTCTTCGTAAC
AGTGCCGCGAACCGAACCGAACCTCTGATTCGTACTCCGGTCGCTGCTCCGGCTTCAACTAGTATCACCGCCGCT
GGTCCGGGTCCCTCGCCCCTCAACCCCAGCCACGCCAGTGCCTCAACCGTAACGGCCGCCCCTCGACCCGCTGCG
CACCCAAACGTCCGCCAGACCCAACAGAGTCAGCAGACCCAGGGTTCGCACGCGATTTCAGCGCCAGCCACGCCG
GCAGCAACAATCATCCTCAACCGTCAGCGCGAAGGCTCGGTCGGTCCGTCATTGAAGCGTATACCACGATCTACA
GCGGCATCTGGCAACGTTCCTGCTGCCTCGAGCAGTCTAGGTCGACACTCCTCGCTAGGCCCAGGCACTCCCAAA
GGCTCGACGGGAGCAGCTGGTGGCGCTGCGTCGCGTGCTGGTAGCGCTGGCCCGCGGACTGGCTCCGTCAAAATT
GCATCAAATGCTACCAGCCGGCGTGGCACGCCCGCTGCAGCCGGACGCAAGAAGGTCGCGAACAAGTCGAATCTT
TCTCGCGTACGCAAAGTTTCGACGCGAGCCTCGCCAACCTCGACGGGAGATAGTGACTTGTCGGAGGCGCAGAGC
ACTAGTGCTAATGACGATGACGATGACGACGACGAGGGCAACGATGTCGGCAGTGTCCAAGAAAGTGCATCTCGG
TCCAAAGGTATGCTGACGGCGTACGTGAGAGATGCTGACGGGGACATGGTGGTGGGAGATGCTGAAGATGACGAT
GAGGGTAGCGACGACAAAAAGTACTGCCTTTGCCACAATGTGAGCTACGGCGACATGGTCGCCTGCGATAATGAT
GACTGCCCCTATGAGTGGTTTCACTGGTCTTGCGTTGGGCTTGAAAGCGAACCCAATGGTACCTGGTATTGTCCC
GAGTGTGCCAAGAAACTCGACAAGAAGAGCAGCAAATAG
Transcript >OphauG2|6774
ATGCCTAGAGACGACTTAACCATCGACTTTGTCAAAAAGATGCCAGCGGTTGATTCACACGATCCAGCCATCATT
ATTGATGACTGGTTCAACCGCGTCCAGAACCTGCCCGAAGAGATTCGCTTTATGCAAGACGAGATCGCCGACAAG
GATCGCCAGTATAACGAACTGATTCGTGGCATTGAGGAGCGCGACTTCAAACTGCAAAGATGGATCAAGACCAAC
GGCAGCCATGTACCCAACCCTAAGGAGGATATACTATGTGCCGAAATCCGTCAGAACTATGCTGCCGCTGAACAA
CTATCTGCGGAAAAAATCGCTCTGACCGAAAGGCTACGTGCCATCTATGACAAGCACTTGCGTAACCTGGATGCC
CAGATTAAACACCTACACGATCGCGGAGAACCCGGCTTCACAGATCCCGATGAATTACCCTCCCTTCTTCGTAAC
AGTGCCGCGAACCGAACCGAACCTCTGATTCGTACTCCGGTCGCTGCTCCGGCTTCAACTAGTATCACCGCCGCT
GGTCCGGGTCCCTCGCCCCTCAACCCCAGCCACGCCAGTGCCTCAACCGTAACGGCCGCCCCTCGACCCGCTGCG
CACCCAAACGTCCGCCAGACCCAACAGAGTCAGCAGACCCAGGGTTCGCACGCGATTTCAGCGCCAGCCACGCCG
GCAGCAACAATCATCCTCAACCGTCAGCGCGAAGGCTCGGTCGGTCCGTCATTGAAGCGTATACCACGATCTACA
GCGGCATCTGGCAACGTTCCTGCTGCCTCGAGCAGTCTAGGTCGACACTCCTCGCTAGGCCCAGGCACTCCCAAA
GGCTCGACGGGAGCAGCTGGTGGCGCTGCGTCGCGTGCTGGTAGCGCTGGCCCGCGGACTGGCTCCGTCAAAATT
GCATCAAATGCTACCAGCCGGCGTGGCACGCCCGCTGCAGCCGGACGCAAGAAGGTCGCGAACAAGTCGAATCTT
TCTCGCGTACGCAAAGTTTCGACGCGAGCCTCGCCAACCTCGACGGGAGATAGTGACTTGTCGGAGGCGCAGAGC
ACTAGTGCTAATGACGATGACGATGACGACGACGAGGGCAACGATGTCGGCAGTGTCCAAGAAAGTGCATCTCGG
TCCAAAGGTATGCTGACGGCGTACGTGAGAGATGCTGACGGGGACATGGTGGTGGGAGATGCTGAAGATGACGAT
GAGGGTAGCGACGACAAAAAGTACTGCCTTTGCCACAATGTGAGCTACGGCGACATGGTCGCCTGCGATAATGAT
GACTGCCCCTATGAGTGGTTTCACTGGTCTTGCGTTGGGCTTGAAAGCGAACCCAATGGTACCTGGTATTGTCCC
GAGTGTGCCAAGAAACTCGACAAGAAGAGCAGCAAATAG
Gene >OphauG2|6774
ATGCCTAGAGACGACTTAACCATCGACTTTGTCAAAAAGATGCCAGCGGTTGATTCACACGATCCAGCCATCATT
ATTGATGACTGGTTCAACCGCGTCCAGAACCTGCCCGAAGAGATTCGCTTTATGCAAGACGAGATCGCCGACAAG
GATCGCCAGTATAACGAACTGATTCGTGGCATTGAGGAGCGCGACTTCAAACTGCAAAGATGGATCAAGACCAAC
GGCAGCCATGTACCCAACCCTAAGGAGGATATACTATGTGCCGAAATCCGTCAGAACTATGCTGCCGCTGAACAA
CTATCTGCGGAAAAAATCGCTCTGACCGAAAGGCTACGTGCCATCTATGACAAGCACTTGCGTAACCTGGATGCC
CAGATTAAACACCTACACGATCGCGGAGAACCCGGCTTCACAGATCCCGATGAATTACCCTCCCTTCTTCGTAAC
AGTGCCGCGAACCGAACCGAACCTCTGATTCGTACTCCGGTCGCTGCTCCGGCTTCAACTAGTATCACCGCCGCT
GGTCCGGGTCCCTCGCCCCTCAACCCCAGCCACGCCAGTGCCTCAACCGTAACGGCCGCCCCTCGACCCGCTGCG
CACCCAAACGTCCGCCAGACCCAACAGAGTCAGCAGACCCAGGGTTCGCACGCGATTTCAGCGCCAGCCACGCCG
GCAGCAACAATCATCCTCAACCGTCAGCGCGAAGGCTCGGTCGGTCCGTCATTGAAGCGTATACCACGATCTACA
GCGGCATCTGGCAACGTTCCTGCTGCCTCGAGCAGTCTAGGTCGACACTCCTCGCTAGGCCCAGGCACTCCCAAA
GGCTCGACGGGAGCAGCTGGTGGCGCTGCGTCGCGTGCTGGTAGCGCTGGCCCGCGGACTGGCTCCGTCAAAATT
GCATCAAATGCTACCAGCCGGCGTGGCACGCCCGCTGCAGCCGGACGCAAGAAGGTCGCGAACAAGTCGAATCTT
TCTCGCGTACGCAAAGTTTCGACGCGAGCCTCGCCAACCTCGACGGGAGATAGTGACTTGTCGGAGGCGCAGAGC
ACTAGTGCTAATGACGATGACGATGACGACGACGAGGGCAACGATGTCGGCAGTGTCCAAGAAAGTGCATCTCGG
TCCAAAGGTATGCTGACGGCGTACGTGAGAGATGCTGACGGGGACATGGTGGTGGGAGATGCTGAAGATGACGAT
GAGGGTAGCGACGACAAAAAGTACTGCCTTTGCCACAATGTGAGCTACGGCGACATGGTCGCCTGCGATAATGAT
GACTGCCCCTATGAGTGGTTTCACTGGTCTTGCGTTGGGCTTGAAAGCGAACCCAATGGTACCTGGTATTGTCCC
GAGTGTGCCAAGAAACTCGACAAGAAGAGCAGCAAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail