Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6773
Gene name
LocationContig_726:3142..4651
Strand-
Gene length (bp)1509
Transcript length (bp)1509
Coding sequence length (bp)1509
Protein length (aa) 503

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00850 Hist_deacetyl Histone deacetylase domain 1.9E-81 89 388

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13298|PHD1_SCHPO Histone deacetylase phd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=phd1 PE=1 SV=1 66 489 5.0E-142
sp|P53096|HOS2_YEAST Probable histone deacetylase HOS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOS2 PE=1 SV=1 72 493 1.0E-135
sp|P56517|HDAC1_CHICK Histone deacetylase 1 OS=Gallus gallus GN=HDAC1 PE=2 SV=1 63 465 8.0E-128
sp|O09106|HDAC1_MOUSE Histone deacetylase 1 OS=Mus musculus GN=Hdac1 PE=1 SV=1 59 465 5.0E-127
sp|Q4QQW4|HDAC1_RAT Histone deacetylase 1 OS=Rattus norvegicus GN=Hdac1 PE=1 SV=1 59 465 6.0E-127
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13298|PHD1_SCHPO Histone deacetylase phd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=phd1 PE=1 SV=1 66 489 5.0E-142
sp|P53096|HOS2_YEAST Probable histone deacetylase HOS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOS2 PE=1 SV=1 72 493 1.0E-135
sp|P56517|HDAC1_CHICK Histone deacetylase 1 OS=Gallus gallus GN=HDAC1 PE=2 SV=1 63 465 8.0E-128
sp|O09106|HDAC1_MOUSE Histone deacetylase 1 OS=Mus musculus GN=Hdac1 PE=1 SV=1 59 465 5.0E-127
sp|Q4QQW4|HDAC1_RAT Histone deacetylase 1 OS=Rattus norvegicus GN=Hdac1 PE=1 SV=1 59 465 6.0E-127
sp|Q32PJ8|HDAC1_BOVIN Histone deacetylase 1 OS=Bos taurus GN=HDAC1 PE=2 SV=1 59 465 6.0E-127
sp|Q5RAG0|HDAC1_PONAB Histone deacetylase 1 OS=Pongo abelii GN=HDAC1 PE=2 SV=1 72 465 6.0E-127
sp|Q13547|HDAC1_HUMAN Histone deacetylase 1 OS=Homo sapiens GN=HDAC1 PE=1 SV=1 72 465 6.0E-127
sp|O42227|HDA1B_XENLA Probable histone deacetylase 1-B OS=Xenopus laevis GN=hdac1-b PE=1 SV=1 72 465 3.0E-126
sp|Q94517|HDAC1_DROME Histone deacetylase Rpd3 OS=Drosophila melanogaster GN=Rpd3 PE=1 SV=2 72 465 4.0E-125
sp|Q9FML2|HDA6_ARATH Histone deacetylase 6 OS=Arabidopsis thaliana GN=HDA6 PE=1 SV=1 58 475 2.0E-123
sp|Q8H0W2|HDA9_ARATH Histone deacetylase 9 OS=Arabidopsis thaliana GN=HDA9 PE=1 SV=1 72 466 2.0E-122
sp|Q55BW2|HDA12_DICDI Histone deacetylase B OS=Dictyostelium discoideum GN=hdaB PE=2 SV=1 72 484 2.0E-122
sp|P56520|HDAC3_CHICK Histone deacetylase 3 OS=Gallus gallus GN=HDAC3 PE=2 SV=1 71 466 4.0E-122
sp|O88895|HDAC3_MOUSE Histone deacetylase 3 OS=Mus musculus GN=Hdac3 PE=1 SV=1 71 484 4.0E-121
sp|O15379|HDAC3_HUMAN Histone deacetylase 3 OS=Homo sapiens GN=HDAC3 PE=1 SV=2 71 466 5.0E-121
sp|Q6P6W3|HDAC3_RAT Histone deacetylase 3 OS=Rattus norvegicus GN=Hdac3 PE=1 SV=1 71 466 5.0E-121
sp|P32561|RPD3_YEAST Histone deacetylase RPD3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPD3 PE=1 SV=1 72 472 5.0E-121
sp|Q803C3|HDAC3_DANRE Histone deacetylase 3 OS=Danio rerio GN=hdac3 PE=2 SV=1 72 466 5.0E-121
sp|Q4SFA0|HDAC3_TETNG Histone deacetylase 3 OS=Tetraodon nigroviridis GN=hdac3 PE=3 SV=1 72 485 2.0E-120
sp|O59702|CLR6_SCHPO Histone deacetylase clr6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=clr6 PE=1 SV=1 72 466 2.0E-120
sp|Q6IRL9|HDAC3_XENLA Histone deacetylase 3 OS=Xenopus laevis GN=hdac3 PE=2 SV=2 71 466 3.0E-120
sp|Q5RB76|HDAC3_PONAB Histone deacetylase 3 OS=Pongo abelii GN=HDAC3 PE=2 SV=1 71 466 3.0E-120
sp|Q28DV3|HDAC3_XENTR Histone deacetylase 3 OS=Xenopus tropicalis GN=hdac3 PE=2 SV=1 71 466 4.0E-120
sp|Q92769|HDAC2_HUMAN Histone deacetylase 2 OS=Homo sapiens GN=HDAC2 PE=1 SV=2 72 465 1.0E-119
sp|P70288|HDAC2_MOUSE Histone deacetylase 2 OS=Mus musculus GN=Hdac2 PE=1 SV=1 72 465 2.0E-119
sp|O17695|HDA1_CAEEL Histone deacetylase 1 OS=Caenorhabditis elegans GN=hda-1 PE=1 SV=1 72 472 2.0E-119
sp|Q55FN5|HDA11_DICDI Type-1 histone deacetylase 1 OS=Dictyostelium discoideum GN=hdaA PE=2 SV=1 72 465 2.0E-119
sp|Q91695|HDA1A_XENLA Probable histone deacetylase 1-A OS=Xenopus laevis GN=hdac1-a PE=1 SV=1 72 465 2.0E-117
sp|P56518|HDAC1_STRPU Histone deacetylase 1 OS=Strongylocentrotus purpuratus GN=HDAC1 PE=2 SV=1 72 488 3.0E-117
sp|P56519|HDAC2_CHICK Histone deacetylase 2 OS=Gallus gallus GN=HDAC2 PE=2 SV=1 72 465 4.0E-115
sp|O22446|HDA19_ARATH Histone deacetylase 19 OS=Arabidopsis thaliana GN=HDA19 PE=1 SV=2 72 465 2.0E-112
sp|Q09440|HDA2_CAEEL Putative histone deacetylase 2 OS=Caenorhabditis elegans GN=hda-2 PE=3 SV=1 68 496 1.0E-106
sp|P56521|HDA19_MAIZE Probable histone deacetylase 19 OS=Zea mays PE=2 SV=1 72 465 3.0E-106
sp|Q9FH09|HDA7_ARATH Histone deacetylase 7 OS=Arabidopsis thaliana GN=HDA7 PE=2 SV=1 72 463 9.0E-90
sp|B1H369|HDAC8_XENTR Histone deacetylase 8 OS=Xenopus tropicalis GN=hdac8 PE=2 SV=1 93 451 7.0E-87
sp|B1WC68|HDAC8_RAT Histone deacetylase 8 OS=Rattus norvegicus GN=Hdac8 PE=2 SV=1 93 451 5.0E-83
sp|Q8VH37|HDAC8_MOUSE Histone deacetylase 8 OS=Mus musculus GN=Hdac8 PE=1 SV=2 93 451 5.0E-83
sp|Q9BY41|HDAC8_HUMAN Histone deacetylase 8 OS=Homo sapiens GN=HDAC8 PE=1 SV=2 93 451 2.0E-82
sp|Q6GPA7|HDAC8_XENLA Histone deacetylase 8 OS=Xenopus laevis GN=hdac8 PE=2 SV=1 118 451 2.0E-81
sp|Q0VCB2|HDAC8_BOVIN Histone deacetylase 8 OS=Bos taurus GN=HDAC8 PE=2 SV=1 93 451 6.0E-81
sp|Q7SXM0|HDAC8_DANRE Histone deacetylase 8 OS=Danio rerio GN=hdac8 PE=2 SV=1 93 451 3.0E-74
sp|Q12214|HOS1_YEAST Histone deacetylase HOS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOS1 PE=1 SV=1 157 391 9.0E-45
sp|P39067|ACUC_BACSU Acetoin utilization protein AcuC OS=Bacillus subtilis (strain 168) GN=acuC PE=3 SV=1 74 383 8.0E-38
sp|Q56195|ACUC_STAXY Acetoin utilization protein AcuC OS=Staphylococcus xylosus GN=acuC PE=3 SV=1 79 385 3.0E-33
sp|Q6GFX3|ACUC_STAAR Acetoin utilization protein AcuC OS=Staphylococcus aureus (strain MRSA252) GN=acuC PE=3 SV=1 82 385 2.0E-32
sp|Q8NW34|ACUC_STAAW Acetoin utilization protein AcuC OS=Staphylococcus aureus (strain MW2) GN=acuC PE=3 SV=1 82 385 1.0E-31
sp|Q6G8J2|ACUC_STAAS Acetoin utilization protein AcuC OS=Staphylococcus aureus (strain MSSA476) GN=acuC PE=3 SV=1 82 385 1.0E-31
sp|Q5HF39|ACUC_STAAC Acetoin utilization protein AcuC OS=Staphylococcus aureus (strain COL) GN=acuC PE=3 SV=1 82 385 2.0E-31
sp|P64375|ACUC_STAAM Acetoin utilization protein AcuC OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=acuC PE=3 SV=1 82 385 4.0E-31
sp|P64376|ACUC_STAAN Acetoin utilization protein AcuC OS=Staphylococcus aureus (strain N315) GN=acuC PE=1 SV=1 82 385 4.0E-31
sp|O30107|Y130_ARCFU Uncharacterized protein AF_0130 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_0130 PE=3 SV=1 82 363 2.0E-27
sp|Q5A960|HDA1_CANAL Histone deacetylase HDA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HDA1 PE=1 SV=1 118 371 1.0E-26
sp|P53973|HDA1_YEAST Histone deacetylase HDA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HDA1 PE=1 SV=1 118 382 4.0E-24
sp|P83038|HDAC4_CHICK Histone deacetylase 4 OS=Gallus gallus GN=HDAC4 PE=2 SV=1 88 353 2.0E-22
sp|P56524|HDAC4_HUMAN Histone deacetylase 4 OS=Homo sapiens GN=HDAC4 PE=1 SV=3 88 457 3.0E-22
sp|Q94EJ2|HDA8_ARATH Histone deacetylase 8 OS=Arabidopsis thaliana GN=HDA8 PE=2 SV=1 115 352 3.0E-22
sp|Q99P99|HDAC4_RAT Histone deacetylase 4 OS=Rattus norvegicus GN=Hdac4 PE=1 SV=2 88 353 4.0E-22
sp|Q6NZM9|HDAC4_MOUSE Histone deacetylase 4 OS=Mus musculus GN=Hdac4 PE=1 SV=1 88 353 5.0E-22
sp|Q9UKV0|HDAC9_HUMAN Histone deacetylase 9 OS=Homo sapiens GN=HDAC9 PE=1 SV=2 69 339 1.0E-21
sp|P56523|CLR3_SCHPO Histone deacetylase clr3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=clr3 PE=1 SV=1 117 347 2.0E-21
sp|O27262|Y1194_METTH Uncharacterized protein MTH_1194 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_1194 PE=3 SV=1 172 382 9.0E-21
sp|Q8WUI4|HDAC7_HUMAN Histone deacetylase 7 OS=Homo sapiens GN=HDAC7 PE=1 SV=2 89 339 3.0E-20
sp|Q20296|HDA6_CAEEL Histone deacetylase 6 OS=Caenorhabditis elegans GN=hda-6 PE=3 SV=2 84 347 7.0E-20
sp|Q8C2B3|HDAC7_MOUSE Histone deacetylase 7 OS=Mus musculus GN=Hdac7 PE=1 SV=2 89 400 8.0E-20
sp|Q80ZH1|HDAC5_CRIGR Histone deacetylase 5 OS=Cricetulus griseus GN=HDAC5 PE=2 SV=1 89 339 5.0E-19
sp|Q8GXJ1|HDA15_ARATH Histone deacetylase 15 OS=Arabidopsis thaliana GN=HDA15 PE=2 SV=2 205 394 5.0E-19
sp|Q9LXN8|HDA17_ARATH Histone deacetylase 17 OS=Arabidopsis thaliana GN=HDA17 PE=2 SV=1 345 466 7.0E-19
sp|Q8LRK8|HDA18_ARATH Histone deacetylase 18 OS=Arabidopsis thaliana GN=HDA18 PE=2 SV=1 170 382 2.0E-18
sp|O17323|HDA4_CAEEL Histone deacetylase 4 OS=Caenorhabditis elegans GN=hda-4 PE=1 SV=3 101 382 3.0E-18
sp|P72702|Y245_SYNY3 Uncharacterized protein slr0245 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0245 PE=3 SV=1 82 382 4.0E-18
sp|Q5R902|HDAC5_PONAB Histone deacetylase 5 OS=Pongo abelii GN=HDAC5 PE=2 SV=1 89 339 5.0E-18
sp|Q9UQL6|HDAC5_HUMAN Histone deacetylase 5 OS=Homo sapiens GN=HDAC5 PE=1 SV=2 89 339 7.0E-18
sp|Q9Z2V6|HDAC5_MOUSE Histone deacetylase 5 OS=Mus musculus GN=Hdac5 PE=1 SV=2 205 339 9.0E-18
sp|Q8RX28|HDA5_ARATH Histone deacetylase 5 OS=Arabidopsis thaliana GN=HDA5 PE=1 SV=1 71 434 1.0E-17
sp|Q9Z2V5|HDAC6_MOUSE Histone deacetylase 6 OS=Mus musculus GN=Hdac6 PE=1 SV=3 89 382 1.0E-17
sp|Q613L4|HDA4_CAEBR Histone deacetylase 4 OS=Caenorhabditis briggsae GN=hda-4 PE=3 SV=1 113 382 3.0E-17
sp|Q3JUN4|APHA_BURP1 Acetylpolyamine aminohydrolase OS=Burkholderia pseudomallei (strain 1710b) GN=aphA PE=1 SV=1 205 374 3.0E-17
sp|Q9UBN7|HDAC6_HUMAN Histone deacetylase 6 OS=Homo sapiens GN=HDAC6 PE=1 SV=2 89 382 3.0E-16
sp|Q969S8|HDA10_HUMAN Histone deacetylase 10 OS=Homo sapiens GN=HDAC10 PE=1 SV=1 92 406 4.0E-16
sp|Q9UBN7|HDAC6_HUMAN Histone deacetylase 6 OS=Homo sapiens GN=HDAC6 PE=1 SV=2 74 381 6.0E-16
sp|Q9Z2V5|HDAC6_MOUSE Histone deacetylase 6 OS=Mus musculus GN=Hdac6 PE=1 SV=3 74 381 7.0E-15
sp|Q57955|Y535_METJA Uncharacterized protein MJ0535 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0535 PE=3 SV=1 77 347 1.0E-14
sp|Q6P3E7|HDA10_MOUSE Histone deacetylase 10 OS=Mus musculus GN=Hdac10 PE=2 SV=2 93 406 2.0E-14
sp|Q569C4|HDA10_RAT Histone deacetylase 10 OS=Rattus norvegicus GN=Hdac10 PE=2 SV=1 205 371 8.0E-14
sp|Q70I53|HDAH_ALCSD Histone deacetylase-like amidohydrolase OS=Alcaligenes sp. (strain DSM 11172) GN=hdaH PE=1 SV=3 83 351 1.0E-13
sp|P28606|Y1628_SYNP2 Uncharacterized protein SYNPCC7002_A1628 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=SYNPCC7002_A1628 PE=3 SV=2 166 374 5.0E-13
sp|Q20296|HDA6_CAEEL Histone deacetylase 6 OS=Caenorhabditis elegans GN=hda-6 PE=3 SV=2 205 380 1.0E-12
sp|Q96DB2|HDA11_HUMAN Histone deacetylase 11 OS=Homo sapiens GN=HDAC11 PE=1 SV=1 179 378 3.0E-12
sp|Q9GKU5|HDA11_MACFA Histone deacetylase 11 OS=Macaca fascicularis GN=HDAC11 PE=2 SV=2 179 378 4.0E-12
sp|Q91WA3|HDA11_MOUSE Histone deacetylase 11 OS=Mus musculus GN=Hdac11 PE=1 SV=1 179 378 9.0E-12
sp|Q48935|APHA_MYCRA Acetylpolyamine aminohydrolase OS=Mycoplana ramosa GN=aphA PE=1 SV=1 145 374 1.0E-11
sp|Q941D6|HDA14_ARATH Histone deacetylase 14 OS=Arabidopsis thaliana GN=HDA14 PE=2 SV=1 205 391 3.0E-11
sp|Q944K3|HDA2_ARATH Histone deacetylase 2 OS=Arabidopsis thaliana GN=HDA2 PE=2 SV=2 179 374 4.0E-11
sp|Q9M1N8|HDA10_ARATH Putative histone deacetylase 10 OS=Arabidopsis thaliana GN=HDA10 PE=3 SV=1 367 466 7.0E-10
sp|Q54VQ7|HDA22_DICDI Type-2 histone deacetylase 2 OS=Dictyostelium discoideum GN=hdaC PE=2 SV=1 82 374 2.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4123
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6773 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5563
Ophiocordyceps camponoti-floridani Ophcf2|00094
Ophiocordyceps camponoti-rufipedis Ophun1|182
Ophiocordyceps kimflemingae Ophio5|126
Ophiocordyceps subramaniannii Hirsu2|8351

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6773
MDASADSPFRFRVPKPNYLPHMVNGDGHARDDIVQEYVPLGLPGDVENFKFFHKCRRQAEESGITRPKGYTVSFH
CNPDMERHHFGMTHPMKPWRLTLSKSLIYSYGMSFAMDNFVSRAATYEELADFHSTDYLDFLGTVLPEPVPRDVE
NQNPDLRFNLGGSDCPLFEGLYDYCSLSAGGALDAARKICSHQSDIAIAWGGGLHHAKKAEASGFCYINDIVLAI
LQLLRQYPRVLYIDIDVHHGDGVEEAFFSTDRVMTCSFHKYDPHNFFPGTGALDDNGPKNEHNAGAHHAVNVPLN
DGITDEQYDMLFNNIVGNIVDKFRPSAVVLQCGADSLAGDRLGRFNLQVQGHGACVEFCKRMSLPLILFGGGGYT
PRNVARAWTYETSIATGCNDKISPILPQHAPWREQFRHDTLFPTLEQILGEPRPNKNTPKRLQEIVQHVTEQLRF
VQAAPSTQMQQVPPDLGGIRDDVEDRIIEEMAERNDELRRIREAAVATPMEF*
Coding >OphauG2|6773
ATGGACGCGTCGGCCGATTCGCCATTTCGCTTTCGCGTCCCAAAGCCAAACTACCTGCCTCACATGGTCAATGGC
GATGGTCACGCCCGCGACGACATTGTCCAGGAATACGTCCCCTTGGGCCTACCCGGCGACGTGGAAAATTTCAAG
TTCTTCCACAAGTGTCGGCGCCAGGCCGAAGAATCCGGCATTACGCGGCCCAAGGGCTACACCGTCTCGTTTCAC
TGTAACCCTGACATGGAACGCCACCACTTTGGAATGACGCATCCAATGAAGCCATGGCGCCTGACTCTATCAAAG
AGCCTCATCTACTCGTATGGCATGTCGTTTGCCATGGACAACTTTGTGTCTCGCGCCGCCACTTACGAGGAACTT
GCCGACTTTCACTCGACTGACTATCTTGATTTTCTGGGCACCGTTTTGCCCGAGCCAGTTCCCCGCGATGTGGAA
AATCAGAACCCGGATCTTAGGTTCAATCTTGGTGGTTCTGATTGTCCGCTCTTTGAGGGTCTCTACGACTATTGC
TCGCTATCAGCCGGTGGCGCTCTTGATGCTGCCCGCAAGATATGCTCCCACCAGTCTGACATTGCCATTGCATGG
GGCGGCGGCTTACATCATGCCAAGAAGGCAGAGGCCTCGGGCTTCTGCTACATCAACGACATTGTCCTGGCCATT
TTACAGCTTCTTCGCCAGTACCCTCGTGTTCTTTACATCGACATCGATGTTCATCACGGCGATGGCGTGGAAGAA
GCCTTCTTTTCCACCGATCGTGTCATGACATGCTCCTTTCACAAGTACGATCCCCACAACTTCTTTCCTGGCACT
GGCGCACTCGACGACAATGGCCCCAAGAACGAGCACAACGCCGGTGCCCATCATGCTGTCAATGTGCCCCTCAAC
GATGGCATCACTGATGAACAGTATGACATGCTATTCAACAATATAGTCGGCAATATTGTCGACAAATTCCGGCCT
AGTGCTGTTGTCTTGCAGTGCGGCGCTGATTCTCTTGCGGGCGACCGACTCGGTCGCTTCAACCTGCAGGTCCAG
GGTCACGGTGCATGTGTCGAGTTTTGCAAACGCATGAGTCTGCCTCTGATTCTCTTTGGTGGTGGCGGCTATACG
CCCCGCAATGTGGCCCGCGCCTGGACATACGAGACGAGCATCGCCACGGGCTGCAACGACAAAATTAGCCCCATT
CTTCCACAGCATGCTCCCTGGCGCGAGCAGTTTCGCCACGATACACTCTTTCCTACTCTTGAGCAAATTCTTGGT
GAGCCTCGACCGAACAAGAACACCCCGAAGCGCCTGCAGGAGATTGTACAGCACGTCACAGAGCAGCTGCGCTTC
GTTCAAGCGGCTCCCAGTACGCAGATGCAACAAGTACCGCCTGATCTCGGTGGCATTAGAGACGATGTTGAAGAC
CGCATCATAGAAGAGATGGCTGAACGAAACGATGAACTGCGACGTATCAGAGAGGCTGCCGTTGCAACTCCAATG
GAGTTTTGA
Transcript >OphauG2|6773
ATGGACGCGTCGGCCGATTCGCCATTTCGCTTTCGCGTCCCAAAGCCAAACTACCTGCCTCACATGGTCAATGGC
GATGGTCACGCCCGCGACGACATTGTCCAGGAATACGTCCCCTTGGGCCTACCCGGCGACGTGGAAAATTTCAAG
TTCTTCCACAAGTGTCGGCGCCAGGCCGAAGAATCCGGCATTACGCGGCCCAAGGGCTACACCGTCTCGTTTCAC
TGTAACCCTGACATGGAACGCCACCACTTTGGAATGACGCATCCAATGAAGCCATGGCGCCTGACTCTATCAAAG
AGCCTCATCTACTCGTATGGCATGTCGTTTGCCATGGACAACTTTGTGTCTCGCGCCGCCACTTACGAGGAACTT
GCCGACTTTCACTCGACTGACTATCTTGATTTTCTGGGCACCGTTTTGCCCGAGCCAGTTCCCCGCGATGTGGAA
AATCAGAACCCGGATCTTAGGTTCAATCTTGGTGGTTCTGATTGTCCGCTCTTTGAGGGTCTCTACGACTATTGC
TCGCTATCAGCCGGTGGCGCTCTTGATGCTGCCCGCAAGATATGCTCCCACCAGTCTGACATTGCCATTGCATGG
GGCGGCGGCTTACATCATGCCAAGAAGGCAGAGGCCTCGGGCTTCTGCTACATCAACGACATTGTCCTGGCCATT
TTACAGCTTCTTCGCCAGTACCCTCGTGTTCTTTACATCGACATCGATGTTCATCACGGCGATGGCGTGGAAGAA
GCCTTCTTTTCCACCGATCGTGTCATGACATGCTCCTTTCACAAGTACGATCCCCACAACTTCTTTCCTGGCACT
GGCGCACTCGACGACAATGGCCCCAAGAACGAGCACAACGCCGGTGCCCATCATGCTGTCAATGTGCCCCTCAAC
GATGGCATCACTGATGAACAGTATGACATGCTATTCAACAATATAGTCGGCAATATTGTCGACAAATTCCGGCCT
AGTGCTGTTGTCTTGCAGTGCGGCGCTGATTCTCTTGCGGGCGACCGACTCGGTCGCTTCAACCTGCAGGTCCAG
GGTCACGGTGCATGTGTCGAGTTTTGCAAACGCATGAGTCTGCCTCTGATTCTCTTTGGTGGTGGCGGCTATACG
CCCCGCAATGTGGCCCGCGCCTGGACATACGAGACGAGCATCGCCACGGGCTGCAACGACAAAATTAGCCCCATT
CTTCCACAGCATGCTCCCTGGCGCGAGCAGTTTCGCCACGATACACTCTTTCCTACTCTTGAGCAAATTCTTGGT
GAGCCTCGACCGAACAAGAACACCCCGAAGCGCCTGCAGGAGATTGTACAGCACGTCACAGAGCAGCTGCGCTTC
GTTCAAGCGGCTCCCAGTACGCAGATGCAACAAGTACCGCCTGATCTCGGTGGCATTAGAGACGATGTTGAAGAC
CGCATCATAGAAGAGATGGCTGAACGAAACGATGAACTGCGACGTATCAGAGAGGCTGCCGTTGCAACTCCAATG
GAGTTTTGA
Gene >OphauG2|6773
ATGGACGCGTCGGCCGATTCGCCATTTCGCTTTCGCGTCCCAAAGCCAAACTACCTGCCTCACATGGTCAATGGC
GATGGTCACGCCCGCGACGACATTGTCCAGGAATACGTCCCCTTGGGCCTACCCGGCGACGTGGAAAATTTCAAG
TTCTTCCACAAGTGTCGGCGCCAGGCCGAAGAATCCGGCATTACGCGGCCCAAGGGCTACACCGTCTCGTTTCAC
TGTAACCCTGACATGGAACGCCACCACTTTGGAATGACGCATCCAATGAAGCCATGGCGCCTGACTCTATCAAAG
AGCCTCATCTACTCGTATGGCATGTCGTTTGCCATGGACAACTTTGTGTCTCGCGCCGCCACTTACGAGGAACTT
GCCGACTTTCACTCGACTGACTATCTTGATTTTCTGGGCACCGTTTTGCCCGAGCCAGTTCCCCGCGATGTGGAA
AATCAGAACCCGGATCTTAGGTTCAATCTTGGTGGTTCTGATTGTCCGCTCTTTGAGGGTCTCTACGACTATTGC
TCGCTATCAGCCGGTGGCGCTCTTGATGCTGCCCGCAAGATATGCTCCCACCAGTCTGACATTGCCATTGCATGG
GGCGGCGGCTTACATCATGCCAAGAAGGCAGAGGCCTCGGGCTTCTGCTACATCAACGACATTGTCCTGGCCATT
TTACAGCTTCTTCGCCAGTACCCTCGTGTTCTTTACATCGACATCGATGTTCATCACGGCGATGGCGTGGAAGAA
GCCTTCTTTTCCACCGATCGTGTCATGACATGCTCCTTTCACAAGTACGATCCCCACAACTTCTTTCCTGGCACT
GGCGCACTCGACGACAATGGCCCCAAGAACGAGCACAACGCCGGTGCCCATCATGCTGTCAATGTGCCCCTCAAC
GATGGCATCACTGATGAACAGTATGACATGCTATTCAACAATATAGTCGGCAATATTGTCGACAAATTCCGGCCT
AGTGCTGTTGTCTTGCAGTGCGGCGCTGATTCTCTTGCGGGCGACCGACTCGGTCGCTTCAACCTGCAGGTCCAG
GGTCACGGTGCATGTGTCGAGTTTTGCAAACGCATGAGTCTGCCTCTGATTCTCTTTGGTGGTGGCGGCTATACG
CCCCGCAATGTGGCCCGCGCCTGGACATACGAGACGAGCATCGCCACGGGCTGCAACGACAAAATTAGCCCCATT
CTTCCACAGCATGCTCCCTGGCGCGAGCAGTTTCGCCACGATACACTCTTTCCTACTCTTGAGCAAATTCTTGGT
GAGCCTCGACCGAACAAGAACACCCCGAAGCGCCTGCAGGAGATTGTACAGCACGTCACAGAGCAGCTGCGCTTC
GTTCAAGCGGCTCCCAGTACGCAGATGCAACAAGTACCGCCTGATCTCGGTGGCATTAGAGACGATGTTGAAGAC
CGCATCATAGAAGAGATGGCTGAACGAAACGATGAACTGCGACGTATCAGAGAGGCTGCCGTTGCAACTCCAATG
GAGTTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail