Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6768
Gene name
LocationContig_723:7467..9449
Strand+
Gene length (bp)1982
Transcript length (bp)1665
Coding sequence length (bp)1665
Protein length (aa) 555

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 4.4E-61 42 505
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 7.4E-10 37 98

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O64411|PAO_MAIZE Polyamine oxidase OS=Zea mays GN=PAO PE=1 SV=1 35 498 7.0E-88
sp|Q9FNA2|PAO1_ARATH Polyamine oxidase 1 OS=Arabidopsis thaliana GN=PAO1 PE=1 SV=1 49 498 3.0E-65
sp|Q9LYT1|PAO3_ARATH Polyamine oxidase 3 OS=Arabidopsis thaliana GN=PAO3 PE=1 SV=1 28 498 5.0E-35
sp|Q8H191|PAO4_ARATH Probable polyamine oxidase 4 OS=Arabidopsis thaliana GN=PAO4 PE=1 SV=1 34 501 9.0E-28
sp|Q9SKX5|PAO2_ARATH Probable polyamine oxidase 2 OS=Arabidopsis thaliana GN=PAO2 PE=2 SV=1 46 501 9.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O64411|PAO_MAIZE Polyamine oxidase OS=Zea mays GN=PAO PE=1 SV=1 35 498 7.0E-88
sp|Q9FNA2|PAO1_ARATH Polyamine oxidase 1 OS=Arabidopsis thaliana GN=PAO1 PE=1 SV=1 49 498 3.0E-65
sp|Q9LYT1|PAO3_ARATH Polyamine oxidase 3 OS=Arabidopsis thaliana GN=PAO3 PE=1 SV=1 28 498 5.0E-35
sp|Q8H191|PAO4_ARATH Probable polyamine oxidase 4 OS=Arabidopsis thaliana GN=PAO4 PE=1 SV=1 34 501 9.0E-28
sp|Q9SKX5|PAO2_ARATH Probable polyamine oxidase 2 OS=Arabidopsis thaliana GN=PAO2 PE=2 SV=1 46 501 9.0E-27
sp|Q8VXV7|LDL1_ARATH Lysine-specific histone demethylase 1 homolog 1 OS=Arabidopsis thaliana GN=LDL1 PE=1 SV=1 35 514 2.0E-26
sp|Q8CIG3|KDM1B_MOUSE Lysine-specific histone demethylase 1B OS=Mus musculus GN=Kdm1b PE=1 SV=1 242 508 1.0E-22
sp|Q8NB78|KDM1B_HUMAN Lysine-specific histone demethylase 1B OS=Homo sapiens GN=KDM1B PE=1 SV=3 242 508 6.0E-22
sp|Q9VW97|LSDA_DROME Possible lysine-specific histone demethylase 1 OS=Drosophila melanogaster GN=Su(var)3-3 PE=1 SV=1 242 506 3.0E-21
sp|Q6YYZ1|LDL2_ORYSJ Lysine-specific histone demethylase 1 homolog 2 OS=Oryza sativa subsp. japonica GN=Os08g0143400 PE=2 SV=1 281 505 8.0E-21
sp|Q9SU79|PAO5_ARATH Probable polyamine oxidase 5 OS=Arabidopsis thaliana GN=PAO5 PE=2 SV=1 30 501 9.0E-21
sp|Q9CAE3|FLD_ARATH Protein FLOWERING LOCUS D OS=Arabidopsis thaliana GN=FLD PE=1 SV=1 32 512 6.0E-20
sp|Q9XWP6|LSD1_CAEEL Probable lysine-specific histone demethylase 1 OS=Caenorhabditis elegans GN=spr-5 PE=1 SV=1 240 507 2.0E-18
sp|O60341|KDM1A_HUMAN Lysine-specific histone demethylase 1A OS=Homo sapiens GN=KDM1A PE=1 SV=2 283 511 5.0E-18
sp|Q01H90|LDL3_ORYSI Lysine-specific histone demethylase 1 homolog 3 OS=Oryza sativa subsp. indica GN=B0103C08-B0602B01.13 PE=3 SV=1 312 514 6.0E-18
sp|Q7XUR2|LDL3_ORYSJ Lysine-specific histone demethylase 1 homolog 3 OS=Oryza sativa subsp. japonica GN=Os04g0560300 PE=2 SV=2 312 514 6.0E-18
sp|Q6ZQ88|KDM1A_MOUSE Lysine-specific histone demethylase 1A OS=Mus musculus GN=Kdm1a PE=1 SV=2 283 511 6.0E-18
sp|P49253|AOF_ONCMY Amine oxidase [flavin-containing] OS=Oncorhynchus mykiss GN=mao PE=2 SV=2 35 505 1.0E-17
sp|Q6Z690|LDL1_ORYSJ Lysine-specific histone demethylase 1 homolog 1 OS=Oryza sativa subsp. japonica GN=Os02g0755200 PE=2 SV=1 243 516 1.0E-17
sp|F4JLS1|LDL3_ARATH Lysine-specific histone demethylase 1 homolog 3 OS=Arabidopsis thaliana GN=LDL3 PE=2 SV=1 261 510 1.0E-17
sp|Q6NSN2|AOF_DANRE Amine oxidase [flavin-containing] OS=Danio rerio GN=mao PE=1 SV=1 35 527 2.0E-17
sp|Q6Q2J0|AOFA_PIG Amine oxidase [flavin-containing] A OS=Sus scrofa GN=MAOA PE=2 SV=1 35 530 4.0E-17
sp|Q9LID0|LDL2_ARATH Lysine-specific histone demethylase 1 homolog 2 OS=Arabidopsis thaliana GN=LDL2 PE=2 SV=1 60 505 4.0E-16
sp|Q865R1|PAOX_BOVIN Peroxisomal N(1)-acetyl-spermine/spermidine oxidase OS=Bos taurus GN=PAOX PE=1 SV=3 297 508 3.0E-15
sp|Q6QHF9|PAOX_HUMAN Peroxisomal N(1)-acetyl-spermine/spermidine oxidase OS=Homo sapiens GN=PAOX PE=1 SV=3 297 508 2.0E-14
sp|Q99K82|SMOX_MOUSE Spermine oxidase OS=Mus musculus GN=Smox PE=1 SV=1 297 510 3.0E-14
sp|Q5RE60|AOFA_PONAB Amine oxidase [flavin-containing] A OS=Pongo abelii GN=MAOA PE=2 SV=1 35 533 3.0E-14
sp|Q9NWM0|SMOX_HUMAN Spermine oxidase OS=Homo sapiens GN=SMOX PE=1 SV=1 291 510 3.0E-14
sp|Q8C0L6|PAOX_MOUSE Peroxisomal N(1)-acetyl-spermine/spermidine oxidase OS=Mus musculus GN=Paox PE=1 SV=3 297 508 8.0E-14
sp|P21398|AOFA_BOVIN Amine oxidase [flavin-containing] A OS=Bos taurus GN=MAOA PE=2 SV=2 280 509 2.0E-13
sp|Q54IT3|AOFA_DICDI Probable flavin-containing monoamine oxidase A OS=Dictyostelium discoideum GN=maoA PE=3 SV=1 35 509 4.0E-13
sp|Q5NU32|AOFA_HORSE Amine oxidase [flavin-containing] A OS=Equus caballus GN=MAOA PE=2 SV=1 280 533 1.0E-12
sp|P58027|AOFA_CANLF Amine oxidase [flavin-containing] A OS=Canis lupus familiaris GN=MAOA PE=2 SV=1 280 514 2.0E-12
sp|Q64133|AOFA_MOUSE Amine oxidase [flavin-containing] A OS=Mus musculus GN=Maoa PE=1 SV=3 280 533 6.0E-12
sp|P21396|AOFA_RAT Amine oxidase [flavin-containing] A OS=Rattus norvegicus GN=Maoa PE=1 SV=1 280 533 1.0E-11
sp|Q55629|Y782_SYNY3 Uncharacterized protein slr0782 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0782 PE=3 SV=1 22 509 7.0E-11
sp|P21397|AOFA_HUMAN Amine oxidase [flavin-containing] A OS=Homo sapiens GN=MAOA PE=1 SV=1 283 533 2.0E-10
sp|Q6PLK3|AOFB_PIG Amine oxidase [flavin-containing] B OS=Sus scrofa GN=MAOB PE=2 SV=3 265 505 2.0E-10
sp|A8QL51|OXLA_BUNMU L-amino-acid oxidase OS=Bungarus multicinctus PE=2 SV=1 35 505 2.0E-10
sp|P9WQ15|AOFH_MYCTU Putative flavin-containing monoamine oxidase AofH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=aofH PE=1 SV=1 280 509 2.0E-10
sp|P9WQ14|AOFH_MYCTO Putative flavin-containing monoamine oxidase AofH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=aofH PE=3 SV=1 280 509 2.0E-10
sp|P63534|AOFH_MYCBO Putative flavin-containing monoamine oxidase AofH OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=aofH PE=3 SV=1 280 509 2.0E-10
sp|Q7YRB7|AOFB_CANLF Amine oxidase [flavin-containing] B OS=Canis lupus familiaris GN=MAOB PE=2 SV=3 283 505 6.0E-10
sp|Q4JHE3|OXLA_OXYSC L-amino-acid oxidase OS=Oxyuranus scutellatus scutellatus PE=2 SV=1 35 505 7.0E-10
sp|Q8BW75|AOFB_MOUSE Amine oxidase [flavin-containing] B OS=Mus musculus GN=Maob PE=1 SV=4 280 505 7.0E-10
sp|P27338|AOFB_HUMAN Amine oxidase [flavin-containing] B OS=Homo sapiens GN=MAOB PE=1 SV=3 280 505 7.0E-10
sp|Q5RE98|AOFB_PONAB Amine oxidase [flavin-containing] B OS=Pongo abelii GN=MAOB PE=2 SV=3 280 505 8.0E-10
sp|P58028|AOFB_CAVPO Amine oxidase [flavin-containing] B OS=Cavia porcellus GN=MAOB PE=2 SV=2 280 505 2.0E-09
sp|P19643|AOFB_RAT Amine oxidase [flavin-containing] B OS=Rattus norvegicus GN=Maob PE=1 SV=3 280 505 3.0E-09
sp|P56560|AOFB_BOVIN Amine oxidase [flavin-containing] B OS=Bos taurus GN=MAOB PE=1 SV=4 265 505 3.0E-09
sp|P86810|OXLA_SIGCA L-amino-acid oxidase OS=Siganus canaliculatus PE=1 SV=2 273 525 4.0E-09
sp|A8QL52|OXLA_BUNFA L-amino-acid oxidase OS=Bungarus fasciatus PE=1 SV=1 35 505 6.0E-09
sp|Q4JHE1|OXLA_PSEAU L-amino-acid oxidase OS=Pseudechis australis PE=1 SV=1 25 497 6.0E-09
sp|A6MFL0|OXLA_DEMVE L-amino-acid oxidase OS=Demansia vestigiata PE=2 SV=1 35 484 6.0E-09
sp|O96566|A37C_DROSI Protein anon-37Cs (Fragment) OS=Drosophila simulans GN=anon-37Cs PE=3 SV=1 298 505 1.0E-08
sp|Q6STF1|OXLA_GLOHA L-amino-acid oxidase OS=Gloydius halys PE=1 SV=1 35 505 4.0E-08
sp|Q4JHE2|OXLA_NOTSC L-amino-acid oxidase OS=Notechis scutatus scutatus PE=2 SV=1 35 505 9.0E-08
sp|P0DI84|OXLA_VIPAA L-amino-acid oxidase OS=Vipera ammodytes ammodytes PE=1 SV=1 252 505 3.0E-07
sp|H8ZPX1|PNAO_PSESP Pseudooxynicotine oxidase OS=Pseudomonas sp. GN=pao PE=1 SV=1 278 512 5.0E-06
sp|O34363|YOBN_BACSU Putative L-amino-acid oxidase YobN OS=Bacillus subtilis (strain 168) GN=yobN PE=3 SV=3 273 506 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6768
MALYAAAAIVAAQIVAAGVAQPPANGHERCRKTTVAILGGGVAGITAAQALSNESISDFLILEYQDRIGGRAHHT
TFGKKQDGSPYTVELGANWARGSRAPGFRVLENQEAQVRLTPPWCLVRQAFGKHQSQKAQIFKAKKHGVANHASD
DESLLTYDHGGYNDYSNLMAAYQEASAKAHEQAGRMLANNEQDQTFRTGLSLAGWNPSHSNMTAHAVEYFGWDWD
ASLPPERSSHIFGAAGNNLTFGYFSPDNLFVTDQRGYSAFVEGEASTFLKAHDKRLLLKTQVTKIDYSEQGVTVH
NADGSCVSAAYAICTFSLGVLQSSVIAYQPQLPEWKQQSIHKFDMGTYTKIFLQFNQTFWPSDKQYLLYASPTTR
GYYPVWQSLSTEGFMPGSNIIFATVTNKESYRIEQQSDEETKREVLAVLGDMFPNTTIPEPTAFMYPRWTQTAWA
RGSYSNWPPSTTLQMHQNLRANLGRLWFAGEATSAEFFGYLHGAWFEGRQAGAQIASLLRGRCAVVWAGQAECGA
RPHYQQLHGTTPLSEYNLLNGWAVSSLGE*
Coding >OphauG2|6768
ATGGCTCTCTACGCTGCAGCAGCCATAGTGGCTGCTCAAATAGTCGCAGCGGGCGTCGCACAGCCGCCCGCCAAT
GGACATGAGCGATGCCGGAAGACCACTGTCGCCATCCTAGGTGGAGGTGTAGCGGGCATCACGGCCGCACAAGCA
TTGTCCAATGAATCCATATCCGATTTCCTCATCCTCGAGTATCAAGACCGCATTGGCGGCAGGGCTCATCACACC
ACCTTTGGCAAGAAGCAAGACGGCTCGCCCTATACAGTTGAGCTGGGTGCTAATTGGGCACGTGGCTCTCGAGCC
CCCGGATTTCGGGTCTTGGAAAACCAGGAGGCCCAGGTCAGGCTCACTCCCCCTTGGTGTCTTGTACGACAGGCC
TTTGGCAAGCACCAATCTCAAAAAGCCCAAATCTTCAAGGCCAAGAAGCATGGCGTGGCCAACCATGCGTCCGAC
GACGAATCCCTCTTGACATATGACCATGGCGGCTACAACGACTATTCGAATCTCATGGCTGCATACCAAGAGGCA
TCGGCCAAGGCTCATGAGCAAGCCGGCAGGATGCTGGCCAACAATGAGCAGGACCAGACGTTTCGCACCGGGCTG
TCTCTGGCTGGATGGAACCCGTCTCACAGCAACATGACGGCGCACGCAGTCGAGTACTTTGGCTGGGATTGGGAC
GCGTCTCTTCCGCCCGAGCGGTCGTCGCACATCTTTGGCGCTGCCGGCAACAACTTGACCTTTGGCTACTTTAGC
CCAGACAACCTCTTTGTGACGGACCAGCGCGGCTACAGCGCCTTTGTCGAGGGCGAGGCATCCACCTTTCTCAAG
GCACACGACAAGCGGCTCCTGCTCAAGACACAGGTGACCAAGATTGACTACTCGGAGCAGGGCGTCACGGTGCAC
AATGCCGACGGCAGCTGTGTCAGTGCAGCATATGCCATTTGCACCTTTTCCCTGGGCGTGCTGCAGAGCTCCGTC
ATTGCCTATCAGCCACAGCTGCCAGAGTGGAAGCAGCAGTCGATTCACAAGTTCGACATGGGCACCTACACCAAG
ATCTTCCTGCAGTTCAACCAGACGTTTTGGCCGAGCGACAAGCAGTATTTGCTGTACGCATCGCCGACGACGCGC
GGCTACTATCCCGTGTGGCAGTCCTTGTCGACCGAGGGCTTCATGCCCGGGTCCAACATCATCTTTGCCACGGTG
ACCAACAAGGAGTCGTATCGCATCGAGCAGCAGTCCGACGAGGAGACCAAGCGCGAGGTGCTGGCTGTTCTTGGC
GACATGTTTCCCAACACGACGATTCCCGAGCCCACAGCCTTTATGTATCCGCGCTGGACCCAGACGGCGTGGGCG
CGGGGCAGCTACTCCAACTGGCCGCCCAGCACGACGCTGCAGATGCACCAGAATCTGCGGGCCAACCTTGGTCGT
CTGTGGTTTGCGGGCGAGGCCACGAGCGCCGAGTTCTTTGGCTACTTGCACGGGGCGTGGTTCGAGGGTCGTCAG
GCGGGTGCGCAGATTGCCAGCCTGCTGCGCGGGCGCTGTGCCGTCGTCTGGGCCGGCCAGGCCGAGTGCGGCGCT
CGGCCACATTACCAGCAGCTGCATGGCACGACGCCGCTGAGCGAGTACAACTTGCTTAACGGCTGGGCAGTCAGC
AGCCTGGGCGAGTGA
Transcript >OphauG2|6768
ATGGCTCTCTACGCTGCAGCAGCCATAGTGGCTGCTCAAATAGTCGCAGCGGGCGTCGCACAGCCGCCCGCCAAT
GGACATGAGCGATGCCGGAAGACCACTGTCGCCATCCTAGGTGGAGGTGTAGCGGGCATCACGGCCGCACAAGCA
TTGTCCAATGAATCCATATCCGATTTCCTCATCCTCGAGTATCAAGACCGCATTGGCGGCAGGGCTCATCACACC
ACCTTTGGCAAGAAGCAAGACGGCTCGCCCTATACAGTTGAGCTGGGTGCTAATTGGGCACGTGGCTCTCGAGCC
CCCGGATTTCGGGTCTTGGAAAACCAGGAGGCCCAGGTCAGGCTCACTCCCCCTTGGTGTCTTGTACGACAGGCC
TTTGGCAAGCACCAATCTCAAAAAGCCCAAATCTTCAAGGCCAAGAAGCATGGCGTGGCCAACCATGCGTCCGAC
GACGAATCCCTCTTGACATATGACCATGGCGGCTACAACGACTATTCGAATCTCATGGCTGCATACCAAGAGGCA
TCGGCCAAGGCTCATGAGCAAGCCGGCAGGATGCTGGCCAACAATGAGCAGGACCAGACGTTTCGCACCGGGCTG
TCTCTGGCTGGATGGAACCCGTCTCACAGCAACATGACGGCGCACGCAGTCGAGTACTTTGGCTGGGATTGGGAC
GCGTCTCTTCCGCCCGAGCGGTCGTCGCACATCTTTGGCGCTGCCGGCAACAACTTGACCTTTGGCTACTTTAGC
CCAGACAACCTCTTTGTGACGGACCAGCGCGGCTACAGCGCCTTTGTCGAGGGCGAGGCATCCACCTTTCTCAAG
GCACACGACAAGCGGCTCCTGCTCAAGACACAGGTGACCAAGATTGACTACTCGGAGCAGGGCGTCACGGTGCAC
AATGCCGACGGCAGCTGTGTCAGTGCAGCATATGCCATTTGCACCTTTTCCCTGGGCGTGCTGCAGAGCTCCGTC
ATTGCCTATCAGCCACAGCTGCCAGAGTGGAAGCAGCAGTCGATTCACAAGTTCGACATGGGCACCTACACCAAG
ATCTTCCTGCAGTTCAACCAGACGTTTTGGCCGAGCGACAAGCAGTATTTGCTGTACGCATCGCCGACGACGCGC
GGCTACTATCCCGTGTGGCAGTCCTTGTCGACCGAGGGCTTCATGCCCGGGTCCAACATCATCTTTGCCACGGTG
ACCAACAAGGAGTCGTATCGCATCGAGCAGCAGTCCGACGAGGAGACCAAGCGCGAGGTGCTGGCTGTTCTTGGC
GACATGTTTCCCAACACGACGATTCCCGAGCCCACAGCCTTTATGTATCCGCGCTGGACCCAGACGGCGTGGGCG
CGGGGCAGCTACTCCAACTGGCCGCCCAGCACGACGCTGCAGATGCACCAGAATCTGCGGGCCAACCTTGGTCGT
CTGTGGTTTGCGGGCGAGGCCACGAGCGCCGAGTTCTTTGGCTACTTGCACGGGGCGTGGTTCGAGGGTCGTCAG
GCGGGTGCGCAGATTGCCAGCCTGCTGCGCGGGCGCTGTGCCGTCGTCTGGGCCGGCCAGGCCGAGTGCGGCGCT
CGGCCACATTACCAGCAGCTGCATGGCACGACGCCGCTGAGCGAGTACAACTTGCTTAACGGCTGGGCAGTCAGC
AGCCTGGGCGAGTGA
Gene >OphauG2|6768
ATGGCTCTCTACGCTGCAGCAGCCATAGTGGCTGCTCAAATAGTCGCAGCGGGCGTCGCACAGCCGCCCGCCAAT
GGACATGAGCGATGCCGGAAGACCACTGTCGCCATCCTGTGAGACCCATATTGCCCTGCTCCAAAAGTCCAAAGG
CTAATCTGCTGCCTTTTCCATCAGAGGTGGAGGTGTAGCGGGCATCACGGCCGCAGTCAGTATACCCGGAATTTG
CACTGTCAATGGAAACGCAATGGACAAGAGGCTGACACGCTGCAATAGCAAGCATTGTCCAATGAATCCATATCC
GATTTCCTCATCCTCGAGTATCAAGACCGCATTGGCGGCAGGGCTCATCACACCACCTTTGGCAAGAAGCAAGAC
GGCTCGCCCTATACAGTTGAGCTGGGTGCTAATTGGGCACGTGGCTCTCGAGCCCCCGGGTCCCATTGACACAGG
GTCCCAATGACAAGGCTCGACTAACGTTGTCTTGAAGATTTCGGGTCTTGGAAAACCAGGAGGCCCAGGTCAGGC
TCACTCCCCCTTGGTGTCTTGTACGGTTGGGGGCGCAAGCGAAACTGACTCGGGACTGCGTAGAAAACCCAATAT
GGACACTGGTAAGCACGCTCTAGACAGGCCTTTGGCAAGCACCAATCTCAAAAAGCCCAAATCTTCAAGGCCAAG
AAGCATGGCGTGGCCAACCATGCGTCCGACGACGAATCCCTCTTGACATATGACCATGGCGGCTACAACGACTAT
TCGAATCTCATGGCTGCATACCAAGAGGCATCGGCCAAGGCTCATGAGCAAGCCGGCAGGATGCTGGCCAACAAT
GAGCAGGACCAGACGTTTCGCACCGGGCTGTCTCTGGCTGGATGGAACCCGTCTCACAGCAACATGACGGCGCAC
GCAGTCGAGTACTTTGGCTGGGGTAAGGCGGGGTGGAAATGCATGAGCAAAGAGAACGAGGCTGAGGGGACAATG
TGTGAGCAGATTGGGACGCGTCTCTTCCGCCCGAGCGGTCGTCGCACATCTTTGGCGCTGCCGGCAACAACTTGA
CCTTTGGCTACTTTAGCCCAGACAACCTCTTTGTGACGGACCAGCGCGGCTACAGCGCCTTTGTCGAGGGCGAGG
CATCCACCTTTCTCAAGGCACACGACAAGCGGCTCCTGCTCAAGACACAGGTGACCAAGATTGACTACTCGGAGC
AGGGCGTCACGGTGCACAATGCCGACGGCAGCTGTGTCAGTGCAGCATATGCCATTTGCACCTTTTCCCTGGGCG
TGCTGCAGAGCTCCGTCATTGCCTATCAGCCACAGCTGCCAGAGTGGAAGCAGCAGTCGATTCACAAGTTCGACA
TGGGCACCTACACCAAGATCTTCCTGCAGTTCAACCAGACGTTTTGGCCGAGCGACAAGCAGTATTTGCTGTACG
CATCGCCGACGACGCGCGGCTACTATCCCGTGTGGCAGTCCTTGTCGACCGAGGGCTTCATGCCCGGGTCCAACA
TCATCTTTGCCACGGTGACCAACAAGGAGTCGTATCGCATCGAGCAGCAGTCCGACGAGGAGACCAAGCGCGAGG
TGCTGGCTGTTCTTGGCGACATGTTTCCCAACACGACGATTCCCGAGCCCACAGCCTTTATGTATCCGCGCTGGA
CCCAGACGGCGTGGGCGCGGGGCAGCTACTCCAACTGGCCGCCCAGCACGACGCTGCAGATGCACCAGAATCTGC
GGGCCAACCTTGGTCGTCTGTGGTTTGCGGGCGAGGCCACGAGCGCCGAGTTCTTTGGCTACTTGCACGGGGCGT
GGTTCGAGGGTCGTCAGGCGGGTGCGCAGATTGCCAGCCTGCTGCGCGGGCGCTGTGCCGTCGTCTGGGCCGGCC
AGGCCGAGTGCGGCGCTCGGCCACATTACCAGCAGCTGCATGGCACGACGCCGCTGAGCGAGTACAACTTGCTTA
ACGGCTGGGCAGTCAGCAGCCTGGGCGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail