Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6768
Gene name
LocationContig_723:7467..9449
Strand+
Gene length (bp)1982
Transcript length (bp)1665
Coding sequence length (bp)1665
Protein length (aa) 555

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 4.4E-61 42 505
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 7.4E-10 37 98

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O64411|PAO_MAIZE Polyamine oxidase OS=Zea mays GN=PAO PE=1 SV=1 35 498 7.0E-88
sp|Q9FNA2|PAO1_ARATH Polyamine oxidase 1 OS=Arabidopsis thaliana GN=PAO1 PE=1 SV=1 49 498 3.0E-65
sp|Q9LYT1|PAO3_ARATH Polyamine oxidase 3 OS=Arabidopsis thaliana GN=PAO3 PE=1 SV=1 28 498 5.0E-35
sp|Q8H191|PAO4_ARATH Probable polyamine oxidase 4 OS=Arabidopsis thaliana GN=PAO4 PE=1 SV=1 34 501 9.0E-28
sp|Q9SKX5|PAO2_ARATH Probable polyamine oxidase 2 OS=Arabidopsis thaliana GN=PAO2 PE=2 SV=1 46 501 9.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O64411|PAO_MAIZE Polyamine oxidase OS=Zea mays GN=PAO PE=1 SV=1 35 498 7.0E-88
sp|Q9FNA2|PAO1_ARATH Polyamine oxidase 1 OS=Arabidopsis thaliana GN=PAO1 PE=1 SV=1 49 498 3.0E-65
sp|Q9LYT1|PAO3_ARATH Polyamine oxidase 3 OS=Arabidopsis thaliana GN=PAO3 PE=1 SV=1 28 498 5.0E-35
sp|Q8H191|PAO4_ARATH Probable polyamine oxidase 4 OS=Arabidopsis thaliana GN=PAO4 PE=1 SV=1 34 501 9.0E-28
sp|Q9SKX5|PAO2_ARATH Probable polyamine oxidase 2 OS=Arabidopsis thaliana GN=PAO2 PE=2 SV=1 46 501 9.0E-27
sp|Q8VXV7|LDL1_ARATH Lysine-specific histone demethylase 1 homolog 1 OS=Arabidopsis thaliana GN=LDL1 PE=1 SV=1 35 514 2.0E-26
sp|Q8CIG3|KDM1B_MOUSE Lysine-specific histone demethylase 1B OS=Mus musculus GN=Kdm1b PE=1 SV=1 242 508 1.0E-22
sp|Q8NB78|KDM1B_HUMAN Lysine-specific histone demethylase 1B OS=Homo sapiens GN=KDM1B PE=1 SV=3 242 508 6.0E-22
sp|Q9VW97|LSDA_DROME Possible lysine-specific histone demethylase 1 OS=Drosophila melanogaster GN=Su(var)3-3 PE=1 SV=1 242 506 3.0E-21
sp|Q6YYZ1|LDL2_ORYSJ Lysine-specific histone demethylase 1 homolog 2 OS=Oryza sativa subsp. japonica GN=Os08g0143400 PE=2 SV=1 281 505 8.0E-21
sp|Q9SU79|PAO5_ARATH Probable polyamine oxidase 5 OS=Arabidopsis thaliana GN=PAO5 PE=2 SV=1 30 501 9.0E-21
sp|Q9CAE3|FLD_ARATH Protein FLOWERING LOCUS D OS=Arabidopsis thaliana GN=FLD PE=1 SV=1 32 512 6.0E-20
sp|Q9XWP6|LSD1_CAEEL Probable lysine-specific histone demethylase 1 OS=Caenorhabditis elegans GN=spr-5 PE=1 SV=1 240 507 2.0E-18
sp|O60341|KDM1A_HUMAN Lysine-specific histone demethylase 1A OS=Homo sapiens GN=KDM1A PE=1 SV=2 283 511 5.0E-18
sp|Q01H90|LDL3_ORYSI Lysine-specific histone demethylase 1 homolog 3 OS=Oryza sativa subsp. indica GN=B0103C08-B0602B01.13 PE=3 SV=1 312 514 6.0E-18
sp|Q7XUR2|LDL3_ORYSJ Lysine-specific histone demethylase 1 homolog 3 OS=Oryza sativa subsp. japonica GN=Os04g0560300 PE=2 SV=2 312 514 6.0E-18
sp|Q6ZQ88|KDM1A_MOUSE Lysine-specific histone demethylase 1A OS=Mus musculus GN=Kdm1a PE=1 SV=2 283 511 6.0E-18
sp|P49253|AOF_ONCMY Amine oxidase [flavin-containing] OS=Oncorhynchus mykiss GN=mao PE=2 SV=2 35 505 1.0E-17
sp|Q6Z690|LDL1_ORYSJ Lysine-specific histone demethylase 1 homolog 1 OS=Oryza sativa subsp. japonica GN=Os02g0755200 PE=2 SV=1 243 516 1.0E-17
sp|F4JLS1|LDL3_ARATH Lysine-specific histone demethylase 1 homolog 3 OS=Arabidopsis thaliana GN=LDL3 PE=2 SV=1 261 510 1.0E-17
sp|Q6NSN2|AOF_DANRE Amine oxidase [flavin-containing] OS=Danio rerio GN=mao PE=1 SV=1 35 527 2.0E-17
sp|Q6Q2J0|AOFA_PIG Amine oxidase [flavin-containing] A OS=Sus scrofa GN=MAOA PE=2 SV=1 35 530 4.0E-17
sp|Q9LID0|LDL2_ARATH Lysine-specific histone demethylase 1 homolog 2 OS=Arabidopsis thaliana GN=LDL2 PE=2 SV=1 60 505 4.0E-16
sp|Q865R1|PAOX_BOVIN Peroxisomal N(1)-acetyl-spermine/spermidine oxidase OS=Bos taurus GN=PAOX PE=1 SV=3 297 508 3.0E-15
sp|Q6QHF9|PAOX_HUMAN Peroxisomal N(1)-acetyl-spermine/spermidine oxidase OS=Homo sapiens GN=PAOX PE=1 SV=3 297 508 2.0E-14
sp|Q99K82|SMOX_MOUSE Spermine oxidase OS=Mus musculus GN=Smox PE=1 SV=1 297 510 3.0E-14
sp|Q5RE60|AOFA_PONAB Amine oxidase [flavin-containing] A OS=Pongo abelii GN=MAOA PE=2 SV=1 35 533 3.0E-14
sp|Q9NWM0|SMOX_HUMAN Spermine oxidase OS=Homo sapiens GN=SMOX PE=1 SV=1 291 510 3.0E-14
sp|Q8C0L6|PAOX_MOUSE Peroxisomal N(1)-acetyl-spermine/spermidine oxidase OS=Mus musculus GN=Paox PE=1 SV=3 297 508 8.0E-14
sp|P21398|AOFA_BOVIN Amine oxidase [flavin-containing] A OS=Bos taurus GN=MAOA PE=2 SV=2 280 509 2.0E-13
sp|Q54IT3|AOFA_DICDI Probable flavin-containing monoamine oxidase A OS=Dictyostelium discoideum GN=maoA PE=3 SV=1 35 509 4.0E-13
sp|Q5NU32|AOFA_HORSE Amine oxidase [flavin-containing] A OS=Equus caballus GN=MAOA PE=2 SV=1 280 533 1.0E-12
sp|P58027|AOFA_CANLF Amine oxidase [flavin-containing] A OS=Canis lupus familiaris GN=MAOA PE=2 SV=1 280 514 2.0E-12
sp|Q64133|AOFA_MOUSE Amine oxidase [flavin-containing] A OS=Mus musculus GN=Maoa PE=1 SV=3 280 533 6.0E-12
sp|P21396|AOFA_RAT Amine oxidase [flavin-containing] A OS=Rattus norvegicus GN=Maoa PE=1 SV=1 280 533 1.0E-11
sp|Q55629|Y782_SYNY3 Uncharacterized protein slr0782 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0782 PE=3 SV=1 22 509 7.0E-11
sp|P21397|AOFA_HUMAN Amine oxidase [flavin-containing] A OS=Homo sapiens GN=MAOA PE=1 SV=1 283 533 2.0E-10
sp|Q6PLK3|AOFB_PIG Amine oxidase [flavin-containing] B OS=Sus scrofa GN=MAOB PE=2 SV=3 265 505 2.0E-10
sp|A8QL51|OXLA_BUNMU L-amino-acid oxidase OS=Bungarus multicinctus PE=2 SV=1 35 505 2.0E-10
sp|P9WQ15|AOFH_MYCTU Putative flavin-containing monoamine oxidase AofH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=aofH PE=1 SV=1 280 509 2.0E-10
sp|P9WQ14|AOFH_MYCTO Putative flavin-containing monoamine oxidase AofH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=aofH PE=3 SV=1 280 509 2.0E-10
sp|P63534|AOFH_MYCBO Putative flavin-containing monoamine oxidase AofH OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=aofH PE=3 SV=1 280 509 2.0E-10
sp|Q7YRB7|AOFB_CANLF Amine oxidase [flavin-containing] B OS=Canis lupus familiaris GN=MAOB PE=2 SV=3 283 505 6.0E-10
sp|Q4JHE3|OXLA_OXYSC L-amino-acid oxidase OS=Oxyuranus scutellatus scutellatus PE=2 SV=1 35 505 7.0E-10
sp|Q8BW75|AOFB_MOUSE Amine oxidase [flavin-containing] B OS=Mus musculus GN=Maob PE=1 SV=4 280 505 7.0E-10
sp|P27338|AOFB_HUMAN Amine oxidase [flavin-containing] B OS=Homo sapiens GN=MAOB PE=1 SV=3 280 505 7.0E-10
sp|Q5RE98|AOFB_PONAB Amine oxidase [flavin-containing] B OS=Pongo abelii GN=MAOB PE=2 SV=3 280 505 8.0E-10
sp|P58028|AOFB_CAVPO Amine oxidase [flavin-containing] B OS=Cavia porcellus GN=MAOB PE=2 SV=2 280 505 2.0E-09
sp|P19643|AOFB_RAT Amine oxidase [flavin-containing] B OS=Rattus norvegicus GN=Maob PE=1 SV=3 280 505 3.0E-09
sp|P56560|AOFB_BOVIN Amine oxidase [flavin-containing] B OS=Bos taurus GN=MAOB PE=1 SV=4 265 505 3.0E-09
sp|P86810|OXLA_SIGCA L-amino-acid oxidase OS=Siganus canaliculatus PE=1 SV=2 273 525 4.0E-09
sp|A8QL52|OXLA_BUNFA L-amino-acid oxidase OS=Bungarus fasciatus PE=1 SV=1 35 505 6.0E-09
sp|Q4JHE1|OXLA_PSEAU L-amino-acid oxidase OS=Pseudechis australis PE=1 SV=1 25 497 6.0E-09
sp|A6MFL0|OXLA_DEMVE L-amino-acid oxidase OS=Demansia vestigiata PE=2 SV=1 35 484 6.0E-09
sp|O96566|A37C_DROSI Protein anon-37Cs (Fragment) OS=Drosophila simulans GN=anon-37Cs PE=3 SV=1 298 505 1.0E-08
sp|Q6STF1|OXLA_GLOHA L-amino-acid oxidase OS=Gloydius halys PE=1 SV=1 35 505 4.0E-08
sp|Q4JHE2|OXLA_NOTSC L-amino-acid oxidase OS=Notechis scutatus scutatus PE=2 SV=1 35 505 9.0E-08
sp|P0DI84|OXLA_VIPAA L-amino-acid oxidase OS=Vipera ammodytes ammodytes PE=1 SV=1 252 505 3.0E-07
sp|H8ZPX1|PNAO_PSESP Pseudooxynicotine oxidase OS=Pseudomonas sp. GN=pao PE=1 SV=1 278 512 5.0E-06
sp|O34363|YOBN_BACSU Putative L-amino-acid oxidase YobN OS=Bacillus subtilis (strain 168) GN=yobN PE=3 SV=3 273 506 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.998624

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3446
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6768 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3856
Ophiocordyceps camponoti-floridani Ophcf2|00545
Ophiocordyceps camponoti-rufipedis Ophun1|3381
Ophiocordyceps kimflemingae Ophio5|7649
Ophiocordyceps subramaniannii Hirsu2|6559

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6768
MALYAAAAIVAAQIVAAGVAQPPANGHERCRKTTVAILGGGVAGITAAQALSNESISDFLILEYQDRIGGRAHHT
TFGKKQDGSPYTVELGANWARGSRAPGFRVLENQEAQVRLTPPWCLVRQAFGKHQSQKAQIFKAKKHGVANHASD
DESLLTYDHGGYNDYSNLMAAYQEASAKAHEQAGRMLANNEQDQTFRTGLSLAGWNPSHSNMTAHAVEYFGWDWD
ASLPPERSSHIFGAAGNNLTFGYFSPDNLFVTDQRGYSAFVEGEASTFLKAHDKRLLLKTQVTKIDYSEQGVTVH
NADGSCVSAAYAICTFSLGVLQSSVIAYQPQLPEWKQQSIHKFDMGTYTKIFLQFNQTFWPSDKQYLLYASPTTR
GYYPVWQSLSTEGFMPGSNIIFATVTNKESYRIEQQSDEETKREVLAVLGDMFPNTTIPEPTAFMYPRWTQTAWA
RGSYSNWPPSTTLQMHQNLRANLGRLWFAGEATSAEFFGYLHGAWFEGRQAGAQIASLLRGRCAVVWAGQAECGA
RPHYQQLHGTTPLSEYNLLNGWAVSSLGE*
Coding >OphauG2|6768
ATGGCTCTCTACGCTGCAGCAGCCATAGTGGCTGCTCAAATAGTCGCAGCGGGCGTCGCACAGCCGCCCGCCAAT
GGACATGAGCGATGCCGGAAGACCACTGTCGCCATCCTAGGTGGAGGTGTAGCGGGCATCACGGCCGCACAAGCA
TTGTCCAATGAATCCATATCCGATTTCCTCATCCTCGAGTATCAAGACCGCATTGGCGGCAGGGCTCATCACACC
ACCTTTGGCAAGAAGCAAGACGGCTCGCCCTATACAGTTGAGCTGGGTGCTAATTGGGCACGTGGCTCTCGAGCC
CCCGGATTTCGGGTCTTGGAAAACCAGGAGGCCCAGGTCAGGCTCACTCCCCCTTGGTGTCTTGTACGACAGGCC
TTTGGCAAGCACCAATCTCAAAAAGCCCAAATCTTCAAGGCCAAGAAGCATGGCGTGGCCAACCATGCGTCCGAC
GACGAATCCCTCTTGACATATGACCATGGCGGCTACAACGACTATTCGAATCTCATGGCTGCATACCAAGAGGCA
TCGGCCAAGGCTCATGAGCAAGCCGGCAGGATGCTGGCCAACAATGAGCAGGACCAGACGTTTCGCACCGGGCTG
TCTCTGGCTGGATGGAACCCGTCTCACAGCAACATGACGGCGCACGCAGTCGAGTACTTTGGCTGGGATTGGGAC
GCGTCTCTTCCGCCCGAGCGGTCGTCGCACATCTTTGGCGCTGCCGGCAACAACTTGACCTTTGGCTACTTTAGC
CCAGACAACCTCTTTGTGACGGACCAGCGCGGCTACAGCGCCTTTGTCGAGGGCGAGGCATCCACCTTTCTCAAG
GCACACGACAAGCGGCTCCTGCTCAAGACACAGGTGACCAAGATTGACTACTCGGAGCAGGGCGTCACGGTGCAC
AATGCCGACGGCAGCTGTGTCAGTGCAGCATATGCCATTTGCACCTTTTCCCTGGGCGTGCTGCAGAGCTCCGTC
ATTGCCTATCAGCCACAGCTGCCAGAGTGGAAGCAGCAGTCGATTCACAAGTTCGACATGGGCACCTACACCAAG
ATCTTCCTGCAGTTCAACCAGACGTTTTGGCCGAGCGACAAGCAGTATTTGCTGTACGCATCGCCGACGACGCGC
GGCTACTATCCCGTGTGGCAGTCCTTGTCGACCGAGGGCTTCATGCCCGGGTCCAACATCATCTTTGCCACGGTG
ACCAACAAGGAGTCGTATCGCATCGAGCAGCAGTCCGACGAGGAGACCAAGCGCGAGGTGCTGGCTGTTCTTGGC
GACATGTTTCCCAACACGACGATTCCCGAGCCCACAGCCTTTATGTATCCGCGCTGGACCCAGACGGCGTGGGCG
CGGGGCAGCTACTCCAACTGGCCGCCCAGCACGACGCTGCAGATGCACCAGAATCTGCGGGCCAACCTTGGTCGT
CTGTGGTTTGCGGGCGAGGCCACGAGCGCCGAGTTCTTTGGCTACTTGCACGGGGCGTGGTTCGAGGGTCGTCAG
GCGGGTGCGCAGATTGCCAGCCTGCTGCGCGGGCGCTGTGCCGTCGTCTGGGCCGGCCAGGCCGAGTGCGGCGCT
CGGCCACATTACCAGCAGCTGCATGGCACGACGCCGCTGAGCGAGTACAACTTGCTTAACGGCTGGGCAGTCAGC
AGCCTGGGCGAGTGA
Transcript >OphauG2|6768
ATGGCTCTCTACGCTGCAGCAGCCATAGTGGCTGCTCAAATAGTCGCAGCGGGCGTCGCACAGCCGCCCGCCAAT
GGACATGAGCGATGCCGGAAGACCACTGTCGCCATCCTAGGTGGAGGTGTAGCGGGCATCACGGCCGCACAAGCA
TTGTCCAATGAATCCATATCCGATTTCCTCATCCTCGAGTATCAAGACCGCATTGGCGGCAGGGCTCATCACACC
ACCTTTGGCAAGAAGCAAGACGGCTCGCCCTATACAGTTGAGCTGGGTGCTAATTGGGCACGTGGCTCTCGAGCC
CCCGGATTTCGGGTCTTGGAAAACCAGGAGGCCCAGGTCAGGCTCACTCCCCCTTGGTGTCTTGTACGACAGGCC
TTTGGCAAGCACCAATCTCAAAAAGCCCAAATCTTCAAGGCCAAGAAGCATGGCGTGGCCAACCATGCGTCCGAC
GACGAATCCCTCTTGACATATGACCATGGCGGCTACAACGACTATTCGAATCTCATGGCTGCATACCAAGAGGCA
TCGGCCAAGGCTCATGAGCAAGCCGGCAGGATGCTGGCCAACAATGAGCAGGACCAGACGTTTCGCACCGGGCTG
TCTCTGGCTGGATGGAACCCGTCTCACAGCAACATGACGGCGCACGCAGTCGAGTACTTTGGCTGGGATTGGGAC
GCGTCTCTTCCGCCCGAGCGGTCGTCGCACATCTTTGGCGCTGCCGGCAACAACTTGACCTTTGGCTACTTTAGC
CCAGACAACCTCTTTGTGACGGACCAGCGCGGCTACAGCGCCTTTGTCGAGGGCGAGGCATCCACCTTTCTCAAG
GCACACGACAAGCGGCTCCTGCTCAAGACACAGGTGACCAAGATTGACTACTCGGAGCAGGGCGTCACGGTGCAC
AATGCCGACGGCAGCTGTGTCAGTGCAGCATATGCCATTTGCACCTTTTCCCTGGGCGTGCTGCAGAGCTCCGTC
ATTGCCTATCAGCCACAGCTGCCAGAGTGGAAGCAGCAGTCGATTCACAAGTTCGACATGGGCACCTACACCAAG
ATCTTCCTGCAGTTCAACCAGACGTTTTGGCCGAGCGACAAGCAGTATTTGCTGTACGCATCGCCGACGACGCGC
GGCTACTATCCCGTGTGGCAGTCCTTGTCGACCGAGGGCTTCATGCCCGGGTCCAACATCATCTTTGCCACGGTG
ACCAACAAGGAGTCGTATCGCATCGAGCAGCAGTCCGACGAGGAGACCAAGCGCGAGGTGCTGGCTGTTCTTGGC
GACATGTTTCCCAACACGACGATTCCCGAGCCCACAGCCTTTATGTATCCGCGCTGGACCCAGACGGCGTGGGCG
CGGGGCAGCTACTCCAACTGGCCGCCCAGCACGACGCTGCAGATGCACCAGAATCTGCGGGCCAACCTTGGTCGT
CTGTGGTTTGCGGGCGAGGCCACGAGCGCCGAGTTCTTTGGCTACTTGCACGGGGCGTGGTTCGAGGGTCGTCAG
GCGGGTGCGCAGATTGCCAGCCTGCTGCGCGGGCGCTGTGCCGTCGTCTGGGCCGGCCAGGCCGAGTGCGGCGCT
CGGCCACATTACCAGCAGCTGCATGGCACGACGCCGCTGAGCGAGTACAACTTGCTTAACGGCTGGGCAGTCAGC
AGCCTGGGCGAGTGA
Gene >OphauG2|6768
ATGGCTCTCTACGCTGCAGCAGCCATAGTGGCTGCTCAAATAGTCGCAGCGGGCGTCGCACAGCCGCCCGCCAAT
GGACATGAGCGATGCCGGAAGACCACTGTCGCCATCCTGTGAGACCCATATTGCCCTGCTCCAAAAGTCCAAAGG
CTAATCTGCTGCCTTTTCCATCAGAGGTGGAGGTGTAGCGGGCATCACGGCCGCAGTCAGTATACCCGGAATTTG
CACTGTCAATGGAAACGCAATGGACAAGAGGCTGACACGCTGCAATAGCAAGCATTGTCCAATGAATCCATATCC
GATTTCCTCATCCTCGAGTATCAAGACCGCATTGGCGGCAGGGCTCATCACACCACCTTTGGCAAGAAGCAAGAC
GGCTCGCCCTATACAGTTGAGCTGGGTGCTAATTGGGCACGTGGCTCTCGAGCCCCCGGGTCCCATTGACACAGG
GTCCCAATGACAAGGCTCGACTAACGTTGTCTTGAAGATTTCGGGTCTTGGAAAACCAGGAGGCCCAGGTCAGGC
TCACTCCCCCTTGGTGTCTTGTACGGTTGGGGGCGCAAGCGAAACTGACTCGGGACTGCGTAGAAAACCCAATAT
GGACACTGGTAAGCACGCTCTAGACAGGCCTTTGGCAAGCACCAATCTCAAAAAGCCCAAATCTTCAAGGCCAAG
AAGCATGGCGTGGCCAACCATGCGTCCGACGACGAATCCCTCTTGACATATGACCATGGCGGCTACAACGACTAT
TCGAATCTCATGGCTGCATACCAAGAGGCATCGGCCAAGGCTCATGAGCAAGCCGGCAGGATGCTGGCCAACAAT
GAGCAGGACCAGACGTTTCGCACCGGGCTGTCTCTGGCTGGATGGAACCCGTCTCACAGCAACATGACGGCGCAC
GCAGTCGAGTACTTTGGCTGGGGTAAGGCGGGGTGGAAATGCATGAGCAAAGAGAACGAGGCTGAGGGGACAATG
TGTGAGCAGATTGGGACGCGTCTCTTCCGCCCGAGCGGTCGTCGCACATCTTTGGCGCTGCCGGCAACAACTTGA
CCTTTGGCTACTTTAGCCCAGACAACCTCTTTGTGACGGACCAGCGCGGCTACAGCGCCTTTGTCGAGGGCGAGG
CATCCACCTTTCTCAAGGCACACGACAAGCGGCTCCTGCTCAAGACACAGGTGACCAAGATTGACTACTCGGAGC
AGGGCGTCACGGTGCACAATGCCGACGGCAGCTGTGTCAGTGCAGCATATGCCATTTGCACCTTTTCCCTGGGCG
TGCTGCAGAGCTCCGTCATTGCCTATCAGCCACAGCTGCCAGAGTGGAAGCAGCAGTCGATTCACAAGTTCGACA
TGGGCACCTACACCAAGATCTTCCTGCAGTTCAACCAGACGTTTTGGCCGAGCGACAAGCAGTATTTGCTGTACG
CATCGCCGACGACGCGCGGCTACTATCCCGTGTGGCAGTCCTTGTCGACCGAGGGCTTCATGCCCGGGTCCAACA
TCATCTTTGCCACGGTGACCAACAAGGAGTCGTATCGCATCGAGCAGCAGTCCGACGAGGAGACCAAGCGCGAGG
TGCTGGCTGTTCTTGGCGACATGTTTCCCAACACGACGATTCCCGAGCCCACAGCCTTTATGTATCCGCGCTGGA
CCCAGACGGCGTGGGCGCGGGGCAGCTACTCCAACTGGCCGCCCAGCACGACGCTGCAGATGCACCAGAATCTGC
GGGCCAACCTTGGTCGTCTGTGGTTTGCGGGCGAGGCCACGAGCGCCGAGTTCTTTGGCTACTTGCACGGGGCGT
GGTTCGAGGGTCGTCAGGCGGGTGCGCAGATTGCCAGCCTGCTGCGCGGGCGCTGTGCCGTCGTCTGGGCCGGCC
AGGCCGAGTGCGGCGCTCGGCCACATTACCAGCAGCTGCATGGCACGACGCCGCTGAGCGAGTACAACTTGCTTA
ACGGCTGGGCAGTCAGCAGCCTGGGCGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail