Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6754
Gene name
LocationContig_72:27128..28529
Strand+
Gene length (bp)1401
Transcript length (bp)1401
Coding sequence length (bp)1401
Protein length (aa) 467

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03738 GSP_synth Glutathionylspermidine synthase preATP-grasp 2.3E-100 14 418

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0ADT5|YGIC_ECOLI Putative acid--amine ligase YgiC OS=Escherichia coli (strain K12) GN=ygiC PE=1 SV=1 1 416 7.0E-52
sp|P0ADT6|YGIC_ECOL6 Putative acid--amine ligase YgiC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ygiC PE=3 SV=1 1 416 7.0E-52
sp|P0ADT7|YGIC_ECO57 Putative acid--amine ligase YgiC OS=Escherichia coli O157:H7 GN=ygiC PE=3 SV=1 1 416 7.0E-52
sp|P44940|Y929_HAEIN Putative acid--amine ligase HI_0929 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0929 PE=3 SV=1 1 416 7.0E-40
sp|P33222|YJFC_ECOLI Putative acid--amine ligase YjfC OS=Escherichia coli (strain K12) GN=yjfC PE=1 SV=2 1 419 7.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0ADT5|YGIC_ECOLI Putative acid--amine ligase YgiC OS=Escherichia coli (strain K12) GN=ygiC PE=1 SV=1 1 416 7.0E-52
sp|P0ADT6|YGIC_ECOL6 Putative acid--amine ligase YgiC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ygiC PE=3 SV=1 1 416 7.0E-52
sp|P0ADT7|YGIC_ECO57 Putative acid--amine ligase YgiC OS=Escherichia coli O157:H7 GN=ygiC PE=3 SV=1 1 416 7.0E-52
sp|P44940|Y929_HAEIN Putative acid--amine ligase HI_0929 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0929 PE=3 SV=1 1 416 7.0E-40
sp|P33222|YJFC_ECOLI Putative acid--amine ligase YjfC OS=Escherichia coli (strain K12) GN=yjfC PE=1 SV=2 1 419 7.0E-39
sp|Q9GT49|TRYS_TRYCC Trypanothione synthetase OS=Trypanosoma cruzi (strain CL Brener) GN=TRS PE=1 SV=1 34 439 7.0E-15
sp|P0AES1|GSP_SHIFL Bifunctional glutathionylspermidine synthetase/amidase OS=Shigella flexneri GN=gss PE=3 SV=1 7 414 2.0E-12
sp|P0AES0|GSP_ECOLI Bifunctional glutathionylspermidine synthetase/amidase OS=Escherichia coli (strain K12) GN=gss PE=1 SV=1 7 414 2.0E-12
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6754
MRRIEVEPRPNSTRLIQSQGLPFATDSYWPDDCYYSFTSDEIALIEQAGHDVFDMCCEAAEYLVEHPDVMVNDMA
IPAFALRQIKESWNREPAWASVVARFDVCFGGLDNPDPALRTPRFYEFNADTPFCLVETACIQWLWLEQTGHGND
QYNTIYESLVQAWTRNLDLVEKALGHRIRFVHFATARGDFDGEEATNTLMLASACREAGWPTRTMAVEQIALSAE
DGRFYDQHGDHIDVIFKVYPYEMMVRERFGEACFRDMDNIGQRDAAGNYTGGTVWIEPPYKMLWSNKALFAILWK
LFKDDPRSKFLIPTYLEHEAPASLNSFARKPIFSRYGQGIQLEQDGHILQKQDDNCYGKEGHVIQELALPPEYKD
SQGRPRYTVLGLWFIDGEPAGLNVREAQSPITDDYAPFIPHSISDGPVGYTPRQIPDADEIEASLRLDRHAYIED
SARVLEYIEQVVYGCE*
Coding >OphauG2|6754
ATGCGTCGAATCGAAGTAGAGCCGCGCCCCAACTCAACCCGGCTTATCCAAAGCCAGGGCCTCCCCTTTGCCACA
GACTCATACTGGCCTGACGACTGCTACTACTCCTTCACCAGCGATGAAATTGCACTCATCGAACAAGCCGGCCAC
GACGTGTTTGACATGTGCTGCGAAGCGGCCGAATACCTCGTCGAGCACCCAGACGTCATGGTCAACGACATGGCG
ATTCCCGCCTTTGCCCTGCGCCAGATTAAAGAATCATGGAACCGCGAGCCAGCATGGGCCAGTGTCGTTGCTCGC
TTCGATGTCTGCTTTGGCGGGCTCGACAACCCGGACCCGGCGCTGCGCACGCCTCGCTTCTACGAGTTCAACGCC
GACACGCCTTTTTGCCTGGTCGAGACGGCCTGTATCCAGTGGCTGTGGCTCGAGCAGACGGGCCACGGCAATGAC
CAGTACAACACCATTTACGAAAGCTTGGTGCAGGCGTGGACGCGGAACCTGGACTTGGTGGAAAAGGCGCTCGGC
CACCGGATTCGCTTCGTGCACTTTGCGACTGCTCGCGGCGACTTTGACGGCGAAGAAGCGACCAACACCCTCATG
CTGGCGTCGGCCTGTCGCGAGGCCGGCTGGCCAACACGTACCATGGCGGTTGAACAGATTGCTCTATCGGCTGAA
GACGGCCGCTTCTACGATCAGCACGGAGACCACATCGACGTCATCTTCAAGGTGTACCCGTATGAGATGATGGTT
CGCGAGAGGTTTGGAGAGGCTTGTTTCCGCGACATGGACAACATTGGCCAACGCGATGCTGCTGGCAACTATACC
GGCGGCACTGTCTGGATCGAGCCGCCGTACAAGATGCTCTGGAGCAACAAGGCCCTCTTTGCTATCCTCTGGAAG
CTCTTCAAGGACGACCCGCGATCCAAGTTCCTCATCCCGACCTATCTCGAGCACGAAGCTCCAGCCTCGCTCAAC
AGCTTTGCCCGCAAGCCCATCTTCTCCCGCTACGGCCAGGGCATCCAGCTCGAGCAGGACGGCCACATTCTCCAG
AAACAAGACGACAACTGCTACGGCAAAGAAGGCCACGTCATCCAAGAGCTGGCCCTGCCGCCCGAGTACAAAGAC
AGTCAGGGCAGGCCCAGGTATACCGTGCTGGGACTCTGGTTCATTGACGGCGAACCGGCCGGGCTAAATGTCCGC
GAGGCGCAGAGTCCAATCACCGACGACTATGCCCCCTTTATCCCTCATTCCATCTCGGATGGACCCGTAGGCTAC
ACACCGCGGCAGATACCGGATGCTGACGAGATTGAGGCGTCCCTCAGGCTAGACAGGCATGCATATATAGAAGAT
AGCGCCAGGGTGCTCGAATATATAGAGCAGGTTGTGTATGGGTGCGAGTAG
Transcript >OphauG2|6754
ATGCGTCGAATCGAAGTAGAGCCGCGCCCCAACTCAACCCGGCTTATCCAAAGCCAGGGCCTCCCCTTTGCCACA
GACTCATACTGGCCTGACGACTGCTACTACTCCTTCACCAGCGATGAAATTGCACTCATCGAACAAGCCGGCCAC
GACGTGTTTGACATGTGCTGCGAAGCGGCCGAATACCTCGTCGAGCACCCAGACGTCATGGTCAACGACATGGCG
ATTCCCGCCTTTGCCCTGCGCCAGATTAAAGAATCATGGAACCGCGAGCCAGCATGGGCCAGTGTCGTTGCTCGC
TTCGATGTCTGCTTTGGCGGGCTCGACAACCCGGACCCGGCGCTGCGCACGCCTCGCTTCTACGAGTTCAACGCC
GACACGCCTTTTTGCCTGGTCGAGACGGCCTGTATCCAGTGGCTGTGGCTCGAGCAGACGGGCCACGGCAATGAC
CAGTACAACACCATTTACGAAAGCTTGGTGCAGGCGTGGACGCGGAACCTGGACTTGGTGGAAAAGGCGCTCGGC
CACCGGATTCGCTTCGTGCACTTTGCGACTGCTCGCGGCGACTTTGACGGCGAAGAAGCGACCAACACCCTCATG
CTGGCGTCGGCCTGTCGCGAGGCCGGCTGGCCAACACGTACCATGGCGGTTGAACAGATTGCTCTATCGGCTGAA
GACGGCCGCTTCTACGATCAGCACGGAGACCACATCGACGTCATCTTCAAGGTGTACCCGTATGAGATGATGGTT
CGCGAGAGGTTTGGAGAGGCTTGTTTCCGCGACATGGACAACATTGGCCAACGCGATGCTGCTGGCAACTATACC
GGCGGCACTGTCTGGATCGAGCCGCCGTACAAGATGCTCTGGAGCAACAAGGCCCTCTTTGCTATCCTCTGGAAG
CTCTTCAAGGACGACCCGCGATCCAAGTTCCTCATCCCGACCTATCTCGAGCACGAAGCTCCAGCCTCGCTCAAC
AGCTTTGCCCGCAAGCCCATCTTCTCCCGCTACGGCCAGGGCATCCAGCTCGAGCAGGACGGCCACATTCTCCAG
AAACAAGACGACAACTGCTACGGCAAAGAAGGCCACGTCATCCAAGAGCTGGCCCTGCCGCCCGAGTACAAAGAC
AGTCAGGGCAGGCCCAGGTATACCGTGCTGGGACTCTGGTTCATTGACGGCGAACCGGCCGGGCTAAATGTCCGC
GAGGCGCAGAGTCCAATCACCGACGACTATGCCCCCTTTATCCCTCATTCCATCTCGGATGGACCCGTAGGCTAC
ACACCGCGGCAGATACCGGATGCTGACGAGATTGAGGCGTCCCTCAGGCTAGACAGGCATGCATATATAGAAGAT
AGCGCCAGGGTGCTCGAATATATAGAGCAGGTTGTGTATGGGTGCGAGTAG
Gene >OphauG2|6754
ATGCGTCGAATCGAAGTAGAGCCGCGCCCCAACTCAACCCGGCTTATCCAAAGCCAGGGCCTCCCCTTTGCCACA
GACTCATACTGGCCTGACGACTGCTACTACTCCTTCACCAGCGATGAAATTGCACTCATCGAACAAGCCGGCCAC
GACGTGTTTGACATGTGCTGCGAAGCGGCCGAATACCTCGTCGAGCACCCAGACGTCATGGTCAACGACATGGCG
ATTCCCGCCTTTGCCCTGCGCCAGATTAAAGAATCATGGAACCGCGAGCCAGCATGGGCCAGTGTCGTTGCTCGC
TTCGATGTCTGCTTTGGCGGGCTCGACAACCCGGACCCGGCGCTGCGCACGCCTCGCTTCTACGAGTTCAACGCC
GACACGCCTTTTTGCCTGGTCGAGACGGCCTGTATCCAGTGGCTGTGGCTCGAGCAGACGGGCCACGGCAATGAC
CAGTACAACACCATTTACGAAAGCTTGGTGCAGGCGTGGACGCGGAACCTGGACTTGGTGGAAAAGGCGCTCGGC
CACCGGATTCGCTTCGTGCACTTTGCGACTGCTCGCGGCGACTTTGACGGCGAAGAAGCGACCAACACCCTCATG
CTGGCGTCGGCCTGTCGCGAGGCCGGCTGGCCAACACGTACCATGGCGGTTGAACAGATTGCTCTATCGGCTGAA
GACGGCCGCTTCTACGATCAGCACGGAGACCACATCGACGTCATCTTCAAGGTGTACCCGTATGAGATGATGGTT
CGCGAGAGGTTTGGAGAGGCTTGTTTCCGCGACATGGACAACATTGGCCAACGCGATGCTGCTGGCAACTATACC
GGCGGCACTGTCTGGATCGAGCCGCCGTACAAGATGCTCTGGAGCAACAAGGCCCTCTTTGCTATCCTCTGGAAG
CTCTTCAAGGACGACCCGCGATCCAAGTTCCTCATCCCGACCTATCTCGAGCACGAAGCTCCAGCCTCGCTCAAC
AGCTTTGCCCGCAAGCCCATCTTCTCCCGCTACGGCCAGGGCATCCAGCTCGAGCAGGACGGCCACATTCTCCAG
AAACAAGACGACAACTGCTACGGCAAAGAAGGCCACGTCATCCAAGAGCTGGCCCTGCCGCCCGAGTACAAAGAC
AGTCAGGGCAGGCCCAGGTATACCGTGCTGGGACTCTGGTTCATTGACGGCGAACCGGCCGGGCTAAATGTCCGC
GAGGCGCAGAGTCCAATCACCGACGACTATGCCCCCTTTATCCCTCATTCCATCTCGGATGGACCCGTAGGCTAC
ACACCGCGGCAGATACCGGATGCTGACGAGATTGAGGCGTCCCTCAGGCTAGACAGGCATGCATATATAGAAGAT
AGCGCCAGGGTGCTCGAATATATAGAGCAGGTTGTGTATGGGTGCGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail