Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6750
Gene name
LocationContig_72:16947..17634
Strand+
Gene length (bp)687
Transcript length (bp)687
Coding sequence length (bp)687
Protein length (aa) 229

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03407 Nucleotid_trans Nucleotide-diphospho-sugar transferase 8.4E-07 20 156
PF05637 Glyco_transf_34 galactosyl transferase GMA12/MNN10 family 5.0E-05 2 140

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0016021 integral component of membrane Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7172
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6750 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1554

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6750
MIHDYAYRFVRAPDFPDRHLTWSKVSIMQAALHEYELVVFLDQDAMFHHPHLPLEWLLNHWNHTSETALMVAQDP
DLPHNKDANGNLFWNTGFIIAQNTSRANELFDAWIECPRDTTSPGCSHYAYNWPHEQGALRTFIQQGLFNRPEDI
HPLPCSEANGSPVALSMSGPGCGGVFVRHFWSEGKSHPPEELADNVMRYFVKQLHGSFLEQGKHVFVDLSGQHDA
KRR*
Coding >OphauG2|6750
ATGATACACGACTATGCCTACCGATTCGTCCGAGCCCCCGACTTTCCCGACCGGCACCTGACATGGTCCAAAGTG
TCAATAATGCAAGCCGCATTACACGAATATGAATTGGTTGTTTTTCTAGACCAGGATGCCATGTTTCATCATCCA
CACCTGCCCTTGGAATGGCTTCTGAACCACTGGAACCACACCTCCGAAACCGCCCTCATGGTAGCTCAAGACCCC
GATTTGCCTCACAACAAGGACGCCAACGGCAATCTCTTCTGGAACACTGGCTTTATTATTGCGCAAAACACCAGC
CGCGCCAACGAGCTCTTTGACGCCTGGATCGAATGCCCTCGCGACACCACATCCCCCGGCTGCAGCCACTACGCC
TATAACTGGCCACACGAACAGGGCGCGCTGAGAACATTTATCCAGCAAGGGCTGTTTAACCGGCCCGAGGACATT
CACCCCTTGCCGTGCTCTGAAGCAAACGGGTCGCCTGTGGCTTTGTCCATGTCTGGGCCTGGATGCGGCGGCGTC
TTTGTGCGACACTTTTGGAGCGAGGGCAAGTCTCATCCGCCTGAAGAGTTGGCTGACAATGTGATGCGCTACTTT
GTGAAGCAGCTGCATGGGTCTTTTCTTGAGCAAGGCAAACACGTCTTTGTTGATTTGTCGGGGCAGCATGATGCG
AAACGCCGCTAA
Transcript >OphauG2|6750
ATGATACACGACTATGCCTACCGATTCGTCCGAGCCCCCGACTTTCCCGACCGGCACCTGACATGGTCCAAAGTG
TCAATAATGCAAGCCGCATTACACGAATATGAATTGGTTGTTTTTCTAGACCAGGATGCCATGTTTCATCATCCA
CACCTGCCCTTGGAATGGCTTCTGAACCACTGGAACCACACCTCCGAAACCGCCCTCATGGTAGCTCAAGACCCC
GATTTGCCTCACAACAAGGACGCCAACGGCAATCTCTTCTGGAACACTGGCTTTATTATTGCGCAAAACACCAGC
CGCGCCAACGAGCTCTTTGACGCCTGGATCGAATGCCCTCGCGACACCACATCCCCCGGCTGCAGCCACTACGCC
TATAACTGGCCACACGAACAGGGCGCGCTGAGAACATTTATCCAGCAAGGGCTGTTTAACCGGCCCGAGGACATT
CACCCCTTGCCGTGCTCTGAAGCAAACGGGTCGCCTGTGGCTTTGTCCATGTCTGGGCCTGGATGCGGCGGCGTC
TTTGTGCGACACTTTTGGAGCGAGGGCAAGTCTCATCCGCCTGAAGAGTTGGCTGACAATGTGATGCGCTACTTT
GTGAAGCAGCTGCATGGGTCTTTTCTTGAGCAAGGCAAACACGTCTTTGTTGATTTGTCGGGGCAGCATGATGCG
AAACGCCGCTAA
Gene >OphauG2|6750
ATGATACACGACTATGCCTACCGATTCGTCCGAGCCCCCGACTTTCCCGACCGGCACCTGACATGGTCCAAAGTG
TCAATAATGCAAGCCGCATTACACGAATATGAATTGGTTGTTTTTCTAGACCAGGATGCCATGTTTCATCATCCA
CACCTGCCCTTGGAATGGCTTCTGAACCACTGGAACCACACCTCCGAAACCGCCCTCATGGTAGCTCAAGACCCC
GATTTGCCTCACAACAAGGACGCCAACGGCAATCTCTTCTGGAACACTGGCTTTATTATTGCGCAAAACACCAGC
CGCGCCAACGAGCTCTTTGACGCCTGGATCGAATGCCCTCGCGACACCACATCCCCCGGCTGCAGCCACTACGCC
TATAACTGGCCACACGAACAGGGCGCGCTGAGAACATTTATCCAGCAAGGGCTGTTTAACCGGCCCGAGGACATT
CACCCCTTGCCGTGCTCTGAAGCAAACGGGTCGCCTGTGGCTTTGTCCATGTCTGGGCCTGGATGCGGCGGCGTC
TTTGTGCGACACTTTTGGAGCGAGGGCAAGTCTCATCCGCCTGAAGAGTTGGCTGACAATGTGATGCGCTACTTT
GTGAAGCAGCTGCATGGGTCTTTTCTTGAGCAAGGCAAACACGTCTTTGTTGATTTGTCGGGGCAGCATGATGCG
AAACGCCGCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail