Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|675
Gene name
LocationContig_117:23062..24150
Strand-
Gene length (bp)1088
Transcript length (bp)999
Coding sequence length (bp)999
Protein length (aa) 333

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00753 Lactamase_B Metallo-beta-lactamase superfamily 6.4E-12 57 184
PF17778 BLACT_WH Beta-lactamase associated winged helix domain 6.1E-05 253 303

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q561R9|LACB2_RAT Beta-lactamase-like protein 2 OS=Rattus norvegicus GN=Lactb2 PE=2 SV=1 33 305 7.0E-60
sp|Q99KR3|LACB2_MOUSE Beta-lactamase-like protein 2 OS=Mus musculus GN=Lactb2 PE=1 SV=1 33 306 2.0E-58
sp|Q1LZ83|LACB2_BOVIN Beta-lactamase-like protein 2 OS=Bos taurus GN=LACTB2 PE=2 SV=1 33 293 9.0E-57
sp|Q53H82|LACB2_HUMAN Beta-lactamase-like protein 2 OS=Homo sapiens GN=LACTB2 PE=1 SV=2 34 274 6.0E-56
sp|Q5XGR8|LACB2_XENLA Beta-lactamase-like protein 2 OS=Xenopus laevis GN=lactb2 PE=2 SV=1 31 303 2.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q561R9|LACB2_RAT Beta-lactamase-like protein 2 OS=Rattus norvegicus GN=Lactb2 PE=2 SV=1 33 305 7.0E-60
sp|Q99KR3|LACB2_MOUSE Beta-lactamase-like protein 2 OS=Mus musculus GN=Lactb2 PE=1 SV=1 33 306 2.0E-58
sp|Q1LZ83|LACB2_BOVIN Beta-lactamase-like protein 2 OS=Bos taurus GN=LACTB2 PE=2 SV=1 33 293 9.0E-57
sp|Q53H82|LACB2_HUMAN Beta-lactamase-like protein 2 OS=Homo sapiens GN=LACTB2 PE=1 SV=2 34 274 6.0E-56
sp|Q5XGR8|LACB2_XENLA Beta-lactamase-like protein 2 OS=Xenopus laevis GN=lactb2 PE=2 SV=1 31 303 2.0E-55
sp|Q0V9A9|LACB2_XENTR Beta-lactamase-like protein 2 OS=Xenopus tropicalis GN=lactb2 PE=2 SV=1 31 303 3.0E-53
sp|Q6NYF0|LACB2_DANRE Beta-lactamase-like protein 2 OS=Danio rerio GN=lactb2 PE=2 SV=1 34 303 5.0E-53
sp|Q95Q18|LACB2_CAEEL Beta-lactamase-like protein 2 homolog OS=Caenorhabditis elegans GN=Y53F4B.39 PE=3 SV=1 31 292 8.0E-48
sp|Q9VLS9|LACB2_DROME Beta-lactamase-like protein 2 homolog OS=Drosophila melanogaster GN=CG12375 PE=2 SV=1 37 307 5.0E-39
sp|Q0BMS2|GLO2_FRATO Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=gloB PE=3 SV=1 80 222 8.0E-18
sp|Q2A4E2|GLO2_FRATH Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=gloB PE=3 SV=1 80 222 8.0E-18
sp|A7NB16|GLO2_FRATF Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=gloB PE=3 SV=1 80 222 8.0E-18
sp|A0Q7M7|GLO2_FRATN Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. novicida (strain U112) GN=gloB PE=3 SV=1 80 222 1.0E-17
sp|A4IWV0|GLO2_FRATW Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=gloB PE=3 SV=1 80 222 2.0E-16
sp|Q5NF43|GLO2_FRATT Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=gloB PE=3 SV=1 80 222 2.0E-16
sp|B2SFR3|GLO2_FRATM Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=gloB PE=3 SV=1 80 222 2.0E-16
sp|Q14GJ6|GLO2_FRAT1 Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=gloB PE=3 SV=1 80 222 2.0E-16
sp|B0TXY0|GLO2_FRAP2 Hydroxyacylglutathione hydrolase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=gloB PE=3 SV=1 80 222 2.0E-15
sp|Q7VD23|GLO2_PROMA Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=gloB PE=3 SV=1 63 256 2.0E-15
sp|Q13F06|GLO2_RHOPS Hydroxyacylglutathione hydrolase OS=Rhodopseudomonas palustris (strain BisB5) GN=gloB PE=3 SV=1 72 196 9.0E-14
sp|A5GJK5|GLO2_SYNPW Hydroxyacylglutathione hydrolase OS=Synechococcus sp. (strain WH7803) GN=gloB PE=3 SV=1 57 192 4.0E-13
sp|Q6NC62|GLO2_RHOPA Hydroxyacylglutathione hydrolase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=gloB PE=3 SV=1 77 196 1.0E-12
sp|Q07VA9|GLO2_RHOP5 Hydroxyacylglutathione hydrolase OS=Rhodopseudomonas palustris (strain BisA53) GN=gloB PE=3 SV=1 91 196 1.0E-12
sp|Q3IIR9|GLO2_PSEHT Hydroxyacylglutathione hydrolase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=gloB PE=3 SV=1 80 229 4.0E-12
sp|Q5E3G3|GLO2_VIBF1 Hydroxyacylglutathione hydrolase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=gloB PE=3 SV=2 80 261 6.0E-12
sp|Q65U07|GLO2_MANSM Hydroxyacylglutathione hydrolase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=gloB PE=3 SV=1 60 222 9.0E-12
sp|Q2J429|GLO2_RHOP2 Hydroxyacylglutathione hydrolase OS=Rhodopseudomonas palustris (strain HaA2) GN=gloB PE=3 SV=1 72 196 1.0E-11
sp|B5F9V3|GLO2_VIBFM Hydroxyacylglutathione hydrolase OS=Vibrio fischeri (strain MJ11) GN=gloB PE=3 SV=1 80 261 1.0E-11
sp|Q60BX0|GLO2_METCA Hydroxyacylglutathione hydrolase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=gloB PE=3 SV=1 76 266 2.0E-11
sp|B6EJV4|GLO2_ALISL Hydroxyacylglutathione hydrolase OS=Aliivibrio salmonicida (strain LFI1238) GN=gloB PE=3 SV=1 80 229 2.0E-11
sp|Q3SVQ1|GLO2_NITWN Hydroxyacylglutathione hydrolase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=gloB PE=3 SV=1 76 205 2.0E-11
sp|Q5N5S6|GLO2_SYNP6 Hydroxyacylglutathione hydrolase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=gloB PE=3 SV=2 80 222 2.0E-11
sp|Q31ND6|GLO2_SYNE7 Hydroxyacylglutathione hydrolase OS=Synechococcus elongatus (strain PCC 7942) GN=gloB PE=3 SV=1 80 222 2.0E-11
sp|Q4FP49|GLO2_PELUB Hydroxyacylglutathione hydrolase OS=Pelagibacter ubique (strain HTCC1062) GN=gloB PE=3 SV=1 72 205 3.0E-11
sp|Q87MG0|GLO2_VIBPA Hydroxyacylglutathione hydrolase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=gloB PE=3 SV=1 80 192 8.0E-11
sp|A1S6T3|GLO2_SHEAM Hydroxyacylglutathione hydrolase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=gloB PE=3 SV=1 80 242 9.0E-11
sp|A9BEI3|GLO2_PROM4 Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain MIT 9211) GN=gloB PE=3 SV=1 63 192 1.0E-10
sp|A2BQ40|GLO2_PROMS Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain AS9601) GN=gloB PE=3 SV=2 45 222 1.0E-10
sp|O94250|GLO22_SCHPO Probable hydroxyacylglutathione hydrolase C13B11.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC13B11.03c PE=3 SV=1 86 192 2.0E-10
sp|A1U0V1|GLO2_MARHV Hydroxyacylglutathione hydrolase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=gloB PE=3 SV=1 80 222 2.0E-10
sp|Q8N490|PNKD_HUMAN Probable hydrolase PNKD OS=Homo sapiens GN=PNKD PE=1 SV=2 72 192 2.0E-10
sp|Q3BWP5|GLO2_XANC5 Hydroxyacylglutathione hydrolase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=gloB PE=3 SV=1 64 203 3.0E-10
sp|A4SPI6|GLO2_AERS4 Hydroxyacylglutathione hydrolase OS=Aeromonas salmonicida (strain A449) GN=gloB PE=3 SV=1 60 238 3.0E-10
sp|A7YY46|PNKD_BOVIN Probable hydrolase PNKD OS=Bos taurus GN=PNKD PE=2 SV=1 72 192 3.0E-10
sp|A7Z4X7|BAEB_BACMF Probable polyketide biosynthesis zinc-dependent hydrolase BaeB OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeB PE=1 SV=1 63 215 3.0E-10
sp|Q89XT5|GLO2_BRADU Hydroxyacylglutathione hydrolase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=gloB PE=3 SV=1 87 205 3.0E-10
sp|Q3AYI2|GLO2_SYNS9 Hydroxyacylglutathione hydrolase OS=Synechococcus sp. (strain CC9902) GN=gloB PE=3 SV=1 57 192 4.0E-10
sp|Q1QQZ1|GLO2_NITHX Hydroxyacylglutathione hydrolase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=gloB PE=3 SV=1 87 205 5.0E-10
sp|A7MY07|GLO2_VIBCB Hydroxyacylglutathione hydrolase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=gloB PE=3 SV=1 80 192 5.0E-10
sp|Q69ZP3|PNKD_MOUSE Probable hydrolase PNKD OS=Mus musculus GN=Pnkd PE=1 SV=2 72 192 7.0E-10
sp|Q21C03|GLO2_RHOPB Hydroxyacylglutathione hydrolase OS=Rhodopseudomonas palustris (strain BisB18) GN=gloB PE=3 SV=1 84 196 1.0E-09
sp|A4YKS8|GLO2_BRASO Hydroxyacylglutathione hydrolase OS=Bradyrhizobium sp. (strain ORS278) GN=gloB PE=3 SV=1 76 196 1.0E-09
sp|A4W6V2|GLO2_ENT38 Hydroxyacylglutathione hydrolase OS=Enterobacter sp. (strain 638) GN=gloB PE=3 SV=1 57 192 1.0E-09
sp|Q7V6G8|GLO2_PROMM Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain MIT 9313) GN=gloB PE=3 SV=1 57 222 1.0E-09
sp|Q46GM1|GLO2_PROMT Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain NATL2A) GN=gloB PE=3 SV=2 72 250 2.0E-09
sp|A2C116|GLO2_PROM1 Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain NATL1A) GN=gloB PE=3 SV=1 72 250 2.0E-09
sp|Q6P963|GLO2_DANRE Hydroxyacylglutathione hydrolase, mitochondrial OS=Danio rerio GN=hagh PE=2 SV=2 72 192 2.0E-09
sp|Q7VM19|GLO2_HAEDU Hydroxyacylglutathione hydrolase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=gloB PE=3 SV=1 57 279 2.0E-09
sp|A6VNK4|GLO2_ACTSZ Hydroxyacylglutathione hydrolase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=gloB PE=3 SV=1 60 283 2.0E-09
sp|Q8PNI0|GLO2_XANAC Hydroxyacylglutathione hydrolase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=gloB PE=3 SV=1 64 203 3.0E-09
sp|Q2JPX4|GLO2_SYNJB Hydroxyacylglutathione hydrolase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=gloB PE=3 SV=1 80 192 4.0E-09
sp|A5ETG1|GLO2_BRASB Hydroxyacylglutathione hydrolase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=gloB PE=3 SV=1 91 205 7.0E-09
sp|B7VIP5|GLO2_VIBTL Hydroxyacylglutathione hydrolase OS=Vibrio tasmaniensis (strain LGP32) GN=gloB PE=3 SV=1 80 229 7.0E-09
sp|Q31BX5|GLO2_PROM9 Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain MIT 9312) GN=gloB PE=3 SV=1 45 222 8.0E-09
sp|A4G7G5|GLO2_HERAR Hydroxyacylglutathione hydrolase OS=Herminiimonas arsenicoxydans GN=gloB PE=3 SV=1 57 238 9.0E-09
sp|O35952|GLO2_RAT Hydroxyacylglutathione hydrolase, mitochondrial OS=Rattus norvegicus GN=Hagh PE=1 SV=2 72 192 9.0E-09
sp|B4F6K2|GLO2_XENTR Hydroxyacylglutathione hydrolase, mitochondrial OS=Xenopus tropicalis GN=hagh PE=2 SV=1 72 192 1.0E-08
sp|Q2RP80|GLO2_RHORT Hydroxyacylglutathione hydrolase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=gloB PE=3 SV=1 80 298 1.0E-08
sp|A3QET2|GLO2_SHELP Hydroxyacylglutathione hydrolase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=gloB PE=3 SV=1 80 271 1.0E-08
sp|Q9UT36|GLO21_SCHPO Probable hydroxyacylglutathione hydrolase C824.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC824.07 PE=3 SV=1 63 186 1.0E-08
sp|Q3B7M2|GLO2_BOVIN Hydroxyacylglutathione hydrolase, mitochondrial OS=Bos taurus GN=HAGH PE=2 SV=3 72 192 1.0E-08
sp|Q46Z82|GLO2_CUPPJ Hydroxyacylglutathione hydrolase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=gloB PE=3 SV=1 57 298 1.0E-08
sp|Q5QZL0|GLO2_IDILO Hydroxyacylglutathione hydrolase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=gloB PE=3 SV=1 57 243 1.0E-08
sp|Q87C74|GLO2_XYLFT Hydroxyacylglutathione hydrolase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=gloB PE=3 SV=1 95 205 2.0E-08
sp|B2I5S5|GLO2_XYLF2 Hydroxyacylglutathione hydrolase OS=Xylella fastidiosa (strain M23) GN=gloB PE=3 SV=1 95 205 2.0E-08
sp|B0U365|GLO2_XYLFM Hydroxyacylglutathione hydrolase OS=Xylella fastidiosa (strain M12) GN=gloB PE=3 SV=1 95 205 2.0E-08
sp|Q7VQB7|GLO2_BLOFL Hydroxyacylglutathione hydrolase OS=Blochmannia floridanus GN=gloB PE=3 SV=1 69 248 2.0E-08
sp|Q9CMW8|GLO2_PASMU Hydroxyacylglutathione hydrolase OS=Pasteurella multocida (strain Pm70) GN=gloB PE=3 SV=1 60 242 2.0E-08
sp|Q9PBI4|GLO2_XYLFA Hydroxyacylglutathione hydrolase OS=Xylella fastidiosa (strain 9a5c) GN=gloB PE=3 SV=1 95 205 2.0E-08
sp|A6WMW5|GLO2_SHEB8 Hydroxyacylglutathione hydrolase OS=Shewanella baltica (strain OS185) GN=gloB PE=3 SV=1 33 239 3.0E-08
sp|A3PBT3|GLO2_PROM0 Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain MIT 9301) GN=gloB PE=3 SV=2 72 278 3.0E-08
sp|C4K7Z9|GLO2_HAMD5 Hydroxyacylglutathione hydrolase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=gloB PE=3 SV=1 80 192 3.0E-08
sp|A3D437|GLO2_SHEB5 Hydroxyacylglutathione hydrolase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=gloB PE=3 SV=1 33 261 3.0E-08
sp|B1WUT9|GLO2_CYAA5 Hydroxyacylglutathione hydrolase OS=Cyanothece sp. (strain ATCC 51142) GN=gloB PE=3 SV=1 80 192 4.0E-08
sp|B7KEB4|GLO2_CYAP7 Hydroxyacylglutathione hydrolase OS=Cyanothece sp. (strain PCC 7424) GN=gloB PE=3 SV=1 80 205 5.0E-08
sp|Q99KB8|GLO2_MOUSE Hydroxyacylglutathione hydrolase, mitochondrial OS=Mus musculus GN=Hagh PE=1 SV=2 72 192 7.0E-08
sp|A2C7W3|GLO2_PROM3 Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain MIT 9303) GN=gloB PE=3 SV=1 57 268 7.0E-08
sp|Q3AL08|GLO2_SYNSC Hydroxyacylglutathione hydrolase OS=Synechococcus sp. (strain CC9605) GN=gloB PE=3 SV=1 57 192 7.0E-08
sp|Q2JVC3|GLO2_SYNJA Hydroxyacylglutathione hydrolase OS=Synechococcus sp. (strain JA-3-3Ab) GN=gloB PE=3 SV=1 80 192 8.0E-08
sp|B4RJC7|GLO2_NEIG2 Hydroxyacylglutathione hydrolase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=gloB PE=3 SV=1 60 254 8.0E-08
sp|B8F6A3|GLO2_HAEPS Hydroxyacylglutathione hydrolase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=gloB PE=3 SV=1 80 205 8.0E-08
sp|B2FR57|GLO2_STRMK Hydroxyacylglutathione hydrolase OS=Stenotrophomonas maltophilia (strain K279a) GN=gloB PE=3 SV=1 72 254 9.0E-08
sp|Q7U5Z8|GLO2_SYNPX Hydroxyacylglutathione hydrolase OS=Synechococcus sp. (strain WH8102) GN=gloB PE=3 SV=1 56 203 9.0E-08
sp|Q7NG34|GLO2_GLOVI Hydroxyacylglutathione hydrolase OS=Gloeobacter violaceus (strain PCC 7421) GN=gloB PE=3 SV=1 80 192 9.0E-08
sp|B0UU01|GLO2_HISS2 Hydroxyacylglutathione hydrolase OS=Histophilus somni (strain 2336) GN=gloB PE=3 SV=1 60 285 1.0E-07
sp|Q0BWR4|GLO2_HYPNA Hydroxyacylglutathione hydrolase OS=Hyphomonas neptunium (strain ATCC 15444) GN=gloB PE=3 SV=1 66 242 1.0E-07
sp|Q9SID3|GLO2N_ARATH Hydroxyacylglutathione hydrolase 2, mitochondrial OS=Arabidopsis thaliana GN=At2g31350 PE=1 SV=1 30 243 1.0E-07
sp|Q0I3Q7|GLO2_HAES1 Hydroxyacylglutathione hydrolase OS=Haemophilus somnus (strain 129Pt) GN=gloB PE=3 SV=1 60 285 1.0E-07
sp|B1XQ70|GLO2_SYNP2 Hydroxyacylglutathione hydrolase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=gloB PE=3 SV=1 70 187 2.0E-07
sp|Q16775|GLO2_HUMAN Hydroxyacylglutathione hydrolase, mitochondrial OS=Homo sapiens GN=HAGH PE=1 SV=2 72 192 2.0E-07
sp|Q5F7J0|GLO2_NEIG1 Hydroxyacylglutathione hydrolase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=gloB PE=3 SV=1 60 222 2.0E-07
sp|B4SLN7|GLO2_STRM5 Hydroxyacylglutathione hydrolase OS=Stenotrophomonas maltophilia (strain R551-3) GN=gloB PE=3 SV=1 72 254 2.0E-07
sp|A1IPQ8|GLO2_NEIMA Hydroxyacylglutathione hydrolase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=gloB PE=3 SV=1 60 254 2.0E-07
sp|Q4R6C1|GLO2_MACFA Hydroxyacylglutathione hydrolase, mitochondrial OS=Macaca fascicularis GN=HAGH PE=2 SV=2 72 192 2.0E-07
sp|C5BEP2|GLO2_EDWI9 Hydroxyacylglutathione hydrolase OS=Edwardsiella ictaluri (strain 93-146) GN=gloB PE=3 SV=1 64 192 2.0E-07
sp|Q3J436|GLO2_RHOS4 Hydroxyacylglutathione hydrolase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=gloB PE=3 SV=1 66 205 2.0E-07
sp|B8E5A2|GLO2_SHEB2 Hydroxyacylglutathione hydrolase OS=Shewanella baltica (strain OS223) GN=gloB PE=3 SV=1 33 239 2.0E-07
sp|A9L0E9|GLO2_SHEB9 Hydroxyacylglutathione hydrolase OS=Shewanella baltica (strain OS195) GN=gloB PE=3 SV=1 33 261 3.0E-07
sp|Q5ZVZ3|GLO2_LEGPH Hydroxyacylglutathione hydrolase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=gloB PE=3 SV=1 73 192 3.0E-07
sp|A3MZD3|GLO2_ACTP2 Hydroxyacylglutathione hydrolase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=gloB PE=3 SV=1 60 279 3.0E-07
sp|A5IBE7|GLO2_LEGPC Hydroxyacylglutathione hydrolase OS=Legionella pneumophila (strain Corby) GN=gloB PE=3 SV=1 73 192 4.0E-07
sp|Q8PBY0|GLO2_XANCP Hydroxyacylglutathione hydrolase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=gloB PE=3 SV=1 80 192 4.0E-07
sp|B0RTE9|GLO2_XANCB Hydroxyacylglutathione hydrolase OS=Xanthomonas campestris pv. campestris (strain B100) GN=gloB PE=3 SV=1 80 192 4.0E-07
sp|Q4URM1|GLO2_XANC8 Hydroxyacylglutathione hydrolase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=gloB PE=3 SV=1 80 192 4.0E-07
sp|A3PIB4|GLO2_RHOS1 Hydroxyacylglutathione hydrolase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=gloB PE=3 SV=1 66 205 4.0E-07
sp|B0BTR9|GLO2_ACTPJ Hydroxyacylglutathione hydrolase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=gloB PE=3 SV=1 60 279 5.0E-07
sp|B3H0S9|GLO2_ACTP7 Hydroxyacylglutathione hydrolase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=gloB PE=3 SV=1 60 279 5.0E-07
sp|Q6PII5|HAGHL_HUMAN Hydroxyacylglutathione hydrolase-like protein OS=Homo sapiens GN=HAGHL PE=2 SV=1 95 189 5.0E-07
sp|Q28333|GLO2_CALJA Hydroxyacylglutathione hydrolase, mitochondrial (Fragment) OS=Callithrix jacchus GN=HAGH PE=2 SV=2 72 192 5.0E-07
sp|A1KW76|GLO2_NEIMF Hydroxyacylglutathione hydrolase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=gloB PE=3 SV=1 60 273 5.0E-07
sp|Q9JXK4|GLO2_NEIMB Hydroxyacylglutathione hydrolase OS=Neisseria meningitidis serogroup B (strain MC58) GN=gloB PE=3 SV=1 60 273 5.0E-07
sp|A9M0M3|GLO2_NEIM0 Hydroxyacylglutathione hydrolase OS=Neisseria meningitidis serogroup C (strain 053442) GN=gloB PE=3 SV=1 60 273 5.0E-07
sp|Q3MGD2|GLO2_ANAVT Hydroxyacylglutathione hydrolase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=gloB PE=3 SV=1 80 192 5.0E-07
sp|A0KXS9|GLO2_SHESA Hydroxyacylglutathione hydrolase OS=Shewanella sp. (strain ANA-3) GN=gloB PE=3 SV=1 80 192 6.0E-07
sp|Q1LL91|GLO2_CUPMC Hydroxyacylglutathione hydrolase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=gloB PE=3 SV=1 57 192 6.0E-07
sp|Q8EE27|GLO2_SHEON Hydroxyacylglutathione hydrolase OS=Shewanella oneidensis (strain MR-1) GN=gloB PE=3 SV=1 80 252 8.0E-07
sp|Q8DBD8|GLO2_VIBVU Hydroxyacylglutathione hydrolase OS=Vibrio vulnificus (strain CMCP6) GN=gloB PE=3 SV=1 80 286 9.0E-07
sp|Q7MII4|GLO22_VIBVY Hydroxyacylglutathione hydrolase 2 OS=Vibrio vulnificus (strain YJ016) GN=gloB2 PE=3 SV=1 80 286 9.0E-07
sp|Q5WX41|GLO2_LEGPL Hydroxyacylglutathione hydrolase OS=Legionella pneumophila (strain Lens) GN=gloB PE=3 SV=1 73 192 1.0E-06
sp|Q21YF8|GLO2_RHOFT Hydroxyacylglutathione hydrolase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=gloB PE=3 SV=2 57 192 1.0E-06
sp|Q5LNN5|GLO2_RUEPO Hydroxyacylglutathione hydrolase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=gloB PE=3 SV=1 72 192 1.0E-06
sp|A1WXD9|GLO2_HALHL Hydroxyacylglutathione hydrolase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=gloB PE=3 SV=1 80 206 1.0E-06
sp|Q8Z983|GLO2_SALTI Hydroxyacylglutathione hydrolase OS=Salmonella typhi GN=gloB PE=3 SV=1 57 192 1.0E-06
sp|B3R1Y0|GLO2_CUPTR Hydroxyacylglutathione hydrolase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=gloB PE=3 SV=1 56 192 1.0E-06
sp|Q5ZI23|GLO2_CHICK Hydroxyacylglutathione hydrolase, mitochondrial OS=Gallus gallus GN=HAGH PE=2 SV=1 72 192 1.0E-06
sp|Q8DIF1|GLO2_THEEB Hydroxyacylglutathione hydrolase OS=Thermosynechococcus elongatus (strain BP-1) GN=gloB PE=3 SV=1 80 192 1.0E-06
sp|Q5X5R2|GLO2_LEGPA Hydroxyacylglutathione hydrolase OS=Legionella pneumophila (strain Paris) GN=gloB PE=3 SV=1 73 192 1.0E-06
sp|Q8YZ99|GLO2_NOSS1 Hydroxyacylglutathione hydrolase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=gloB PE=3 SV=1 80 192 1.0E-06
sp|Q2P6Y4|GLO2_XANOM Hydroxyacylglutathione hydrolase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=gloB PE=3 SV=1 80 211 1.0E-06
sp|P75849|YCBL_ECOLI Uncharacterized protein YcbL OS=Escherichia coli (strain K12) GN=ycbL PE=3 SV=1 84 186 2.0E-06
sp|A1JKA9|GLO2_YERE8 Hydroxyacylglutathione hydrolase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=gloB PE=3 SV=1 57 192 2.0E-06
sp|A6T510|GLO2_KLEP7 Hydroxyacylglutathione hydrolase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=gloB PE=3 SV=1 57 192 2.0E-06
sp|B5Y1G4|GLO2_KLEP3 Hydroxyacylglutathione hydrolase OS=Klebsiella pneumoniae (strain 342) GN=gloB PE=3 SV=1 57 192 2.0E-06
sp|B2IVH7|GLO2_NOSP7 Hydroxyacylglutathione hydrolase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=gloB PE=3 SV=1 80 184 3.0E-06
sp|B7K3R6|GLO2_CYAP8 Hydroxyacylglutathione hydrolase OS=Cyanothece sp. (strain PCC 8801) GN=gloB PE=3 SV=1 80 203 3.0E-06
sp|Q08889|GLO2_BUCAP Hydroxyacylglutathione hydrolase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=gloB PE=3 SV=1 80 191 3.0E-06
sp|P71374|GLO2_HAEIN Hydroxyacylglutathione hydrolase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gloB PE=3 SV=1 61 222 3.0E-06
sp|C3LPP0|GLO2_VIBCM Hydroxyacylglutathione hydrolase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=gloB PE=3 SV=1 75 229 4.0E-06
sp|Q9KPX6|GLO2_VIBCH Hydroxyacylglutathione hydrolase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=gloB PE=3 SV=1 75 229 4.0E-06
sp|A5F635|GLO2_VIBC3 Hydroxyacylglutathione hydrolase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=gloB PE=3 SV=1 75 229 4.0E-06
sp|Q6ML19|GLO2_BDEBA Hydroxyacylglutathione hydrolase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=gloB PE=3 SV=1 78 203 4.0E-06
sp|Q3JAC4|GLO2_NITOC Hydroxyacylglutathione hydrolase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=gloB PE=3 SV=1 89 244 4.0E-06
sp|B0TRL8|GLO2_SHEHH Hydroxyacylglutathione hydrolase OS=Shewanella halifaxensis (strain HAW-EB4) GN=gloB PE=3 SV=1 80 192 5.0E-06
sp|Q47FN7|GLO2_DECAR Hydroxyacylglutathione hydrolase OS=Dechloromonas aromatica (strain RCB) GN=gloB PE=3 SV=1 56 192 6.0E-06
sp|B0JW10|GLO2_MICAN Hydroxyacylglutathione hydrolase OS=Microcystis aeruginosa (strain NIES-843) GN=gloB PE=3 SV=1 80 192 6.0E-06
sp|Q92MF8|GLO2_RHIME Hydroxyacylglutathione hydrolase OS=Rhizobium meliloti (strain 1021) GN=gloB PE=3 SV=1 70 242 6.0E-06
sp|Q10Y41|GLO2_TRIEI Hydroxyacylglutathione hydrolase OS=Trichodesmium erythraeum (strain IMS101) GN=gloB PE=3 SV=1 80 192 6.0E-06
sp|Q12BV7|GLO2_POLSJ Hydroxyacylglutathione hydrolase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=gloB PE=3 SV=1 89 229 7.0E-06
sp|A4Y6B8|GLO2_SHEPC Hydroxyacylglutathione hydrolase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=gloB PE=3 SV=1 33 192 7.0E-06
sp|A1RK78|GLO2_SHESW Hydroxyacylglutathione hydrolase OS=Shewanella sp. (strain W3-18-1) GN=gloB PE=3 SV=1 33 192 8.0E-06
sp|B8ICA2|GLO2_METNO Hydroxyacylglutathione hydrolase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=gloB PE=3 SV=1 91 256 8.0E-06
sp|B0BZI8|GLO2_ACAM1 Hydroxyacylglutathione hydrolase OS=Acaryochloris marina (strain MBIC 11017) GN=gloB PE=3 SV=1 80 192 9.0E-06
sp|O24496|GLO2C_ARATH Hydroxyacylglutathione hydrolase cytoplasmic OS=Arabidopsis thaliana GN=GLX2-2 PE=1 SV=2 72 210 9.0E-06
sp|A6VVZ9|GLO2_MARMS Hydroxyacylglutathione hydrolase OS=Marinomonas sp. (strain MWYL1) GN=gloB PE=3 SV=1 78 186 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|675
MVTTHKAARLMVKSYNICAFEDFLERQRERLPSLANVQQLSPRVLRVLGQNPGQFTFQGTNTYIVGTGRERLIID
TSAGEPAWAQLISSTLQHMGVTLSQVLLTHWHGDHTGGVPDLVRMYPHVKDAVYKNDPDKGQRNICDGQVFRVEG
ATVRALHVPGHAEDHMCFLLDEEQAMFTGDNILGHGSSVVYDLGTFTNSLRRMHAQRCATGYPAHGDVIANLPAK
IASELAIKLRRERQVLQALQRDKSSSMTVRSLVNAIYSEQLDEELRTMALEPFVHEVLRKLAGDGKVAFAMRGGV
QRWYAVQTAQRTEGHEHVVEVASMRTGLVVEA*
Coding >OphauG2|675
ATGGTGACCACACACAAGGCGGCGCGACTCATGGTCAAGTCGTACAACATTTGCGCCTTTGAAGACTTTCTCGAG
CGGCAGAGAGAGCGTCTGCCCAGTCTGGCTAATGTGCAGCAGCTAAGCCCTCGAGTGCTGCGCGTGCTGGGCCAG
AATCCAGGACAGTTTACATTTCAGGGGACAAATACCTACATCGTCGGCACGGGCCGCGAGAGACTCATCATTGAC
ACCTCAGCAGGCGAGCCTGCCTGGGCCCAACTCATCTCGAGCACCCTGCAGCACATGGGCGTCACGCTGTCTCAG
GTCCTCTTGACCCATTGGCATGGCGATCACACTGGCGGGGTTCCTGACCTTGTGCGCATGTATCCGCATGTCAAG
GATGCTGTTTACAAGAACGACCCGGACAAGGGCCAGCGCAACATTTGCGACGGCCAAGTCTTTCGTGTAGAGGGC
GCGACGGTGCGCGCGCTGCACGTGCCGGGCCATGCCGAGGACCACATGTGCTTCTTGCTCGACGAGGAGCAGGCC
ATGTTTACGGGCGACAACATCCTGGGCCACGGTAGCAGCGTCGTATACGATCTTGGCACCTTTACCAACTCGTTG
CGGCGCATGCACGCCCAGCGGTGCGCCACTGGCTATCCAGCGCACGGAGACGTCATTGCCAACCTGCCGGCAAAG
ATTGCGAGCGAGCTGGCCATTAAGCTGAGGCGTGAGCGGCAAGTACTGCAGGCGCTGCAGCGGGACAAGAGCTCA
AGTATGACGGTGCGCAGCCTTGTCAATGCCATTTACAGCGAGCAGCTCGACGAGGAGCTGCGCACCATGGCGCTG
GAGCCCTTTGTGCACGAGGTGCTGCGCAAGTTGGCGGGCGACGGCAAGGTGGCGTTTGCCATGAGGGGGGGTGTT
CAGCGGTGGTATGCGGTGCAGACGGCGCAGCGGACCGAGGGGCACGAGCATGTCGTCGAGGTGGCGTCAATGAGA
ACGGGGTTGGTGGTGGAGGCTTAG
Transcript >OphauG2|675
ATGGTGACCACACACAAGGCGGCGCGACTCATGGTCAAGTCGTACAACATTTGCGCCTTTGAAGACTTTCTCGAG
CGGCAGAGAGAGCGTCTGCCCAGTCTGGCTAATGTGCAGCAGCTAAGCCCTCGAGTGCTGCGCGTGCTGGGCCAG
AATCCAGGACAGTTTACATTTCAGGGGACAAATACCTACATCGTCGGCACGGGCCGCGAGAGACTCATCATTGAC
ACCTCAGCAGGCGAGCCTGCCTGGGCCCAACTCATCTCGAGCACCCTGCAGCACATGGGCGTCACGCTGTCTCAG
GTCCTCTTGACCCATTGGCATGGCGATCACACTGGCGGGGTTCCTGACCTTGTGCGCATGTATCCGCATGTCAAG
GATGCTGTTTACAAGAACGACCCGGACAAGGGCCAGCGCAACATTTGCGACGGCCAAGTCTTTCGTGTAGAGGGC
GCGACGGTGCGCGCGCTGCACGTGCCGGGCCATGCCGAGGACCACATGTGCTTCTTGCTCGACGAGGAGCAGGCC
ATGTTTACGGGCGACAACATCCTGGGCCACGGTAGCAGCGTCGTATACGATCTTGGCACCTTTACCAACTCGTTG
CGGCGCATGCACGCCCAGCGGTGCGCCACTGGCTATCCAGCGCACGGAGACGTCATTGCCAACCTGCCGGCAAAG
ATTGCGAGCGAGCTGGCCATTAAGCTGAGGCGTGAGCGGCAAGTACTGCAGGCGCTGCAGCGGGACAAGAGCTCA
AGTATGACGGTGCGCAGCCTTGTCAATGCCATTTACAGCGAGCAGCTCGACGAGGAGCTGCGCACCATGGCGCTG
GAGCCCTTTGTGCACGAGGTGCTGCGCAAGTTGGCGGGCGACGGCAAGGTGGCGTTTGCCATGAGGGGGGGTGTT
CAGCGGTGGTATGCGGTGCAGACGGCGCAGCGGACCGAGGGGCACGAGCATGTCGTCGAGGTGGCGTCAATGAGA
ACGGGGTTGGTGGTGGAGGCTTAG
Gene >OphauG2|675
ATGGTGACCACACACAAGGCGGCGCGACTCATGGTCAAGTCGTACAACATTTGCGCCTTTGAAGACTTTCTCGAG
CGGCAGAGAGAGCGTCTGCCCAGTCTGGCTAATGTGCAGCAGCTAAGCCCTCGAGTGCTGCGCGTGCTGGGCCAG
AATCCAGGACAGGTAACACACGCCGATGATCATTGCCCAAAGCAAGGCTGGTGCAGCACAGACTGATGCATCTTG
TTTGCTTTCTCGACTGCTGCGTGCAGTTTACATTTCAGGGGACAAATACCTACATCGTCGGCACGGGCCGCGAGA
GACTCATCATTGACACCTCAGCAGGCGAGCCTGCCTGGGCCCAACTCATCTCGAGCACCCTGCAGCACATGGGCG
TCACGCTGTCTCAGGTCCTCTTGACCCATTGGCATGGCGATCACACTGGCGGGGTTCCTGACCTTGTGCGCATGT
ATCCGCATGTCAAGGATGCTGTTTACAAGAACGACCCGGACAAGGGCCAGCGCAACATTTGCGACGGCCAAGTCT
TTCGTGTAGAGGGCGCGACGGTGCGCGCGCTGCACGTGCCGGGCCATGCCGAGGACCACATGTGCTTCTTGCTCG
ACGAGGAGCAGGCCATGTTTACGGGCGACAACATCCTGGGCCACGGTAGCAGCGTCGTATACGATCTTGGCACCT
TTACCAACTCGTTGCGGCGCATGCACGCCCAGCGGTGCGCCACTGGCTATCCAGCGCACGGAGACGTCATTGCCA
ACCTGCCGGCAAAGATTGCGAGCGAGCTGGCCATTAAGCTGAGGCGTGAGCGGCAAGTACTGCAGGCGCTGCAGC
GGGACAAGAGCTCAAGTATGACGGTGCGCAGCCTTGTCAATGCCATTTACAGCGAGCAGCTCGACGAGGAGCTGC
GCACCATGGCGCTGGAGCCCTTTGTGCACGAGGTGCTGCGCAAGTTGGCGGGCGACGGCAAGGTGGCGTTTGCCA
TGAGGGGGGGTGTTCAGCGGTGGTATGCGGTGCAGACGGCGCAGCGGACCGAGGGGCACGAGCATGTCGTCGAGG
TGGCGTCAATGAGAACGGGGTTGGTGGTGGAGGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail