Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6741
Gene name
LocationContig_72:358..1210
Strand+
Gene length (bp)852
Transcript length (bp)741
Coding sequence length (bp)741
Protein length (aa) 247

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 35 57 22
2 70 92 22
3 118 140 22
4 152 174 22
5 202 224 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup128
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6741 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|6742
Ophiocordyceps australis map64 (Brazil) OphauB2|1550
Ophiocordyceps camponoti-floridani Ophcf2|01321
Ophiocordyceps camponoti-floridani Ophcf2|06773
Ophiocordyceps camponoti-rufipedis Ophun1|3805
Ophiocordyceps camponoti-rufipedis Ophun1|5428
Ophiocordyceps kimflemingae Ophio5|2627
Ophiocordyceps kimflemingae Ophio5|7426
Ophiocordyceps subramaniannii Hirsu2|10422
Ophiocordyceps subramaniannii Hirsu2|561
Ophiocordyceps subramaniannii Hirsu2|6268
Ophiocordyceps subramaniannii Hirsu2|6488

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6741
MMDPKVVEAFASGRLPNPEAPNATPEFLNESRDKPAIIGILIVTALTATVVVGRLLSRAFVVRRFGFDDGLALVS
LVVFAAFVGLCIELIRLGSGRHFDYIQYVLDVPTVQTTQVLDFAAHIVYSTALLLCRVSGLAFYYRVCGMHHGFH
VAIRAVFVILVAAYLPQILLVIFHCRPVTGLWPYGWEPGTEQYVCLQWGLVYVVISTISLFCDLLLFGIPVAMLK
ILEMPRRRKIQLGCILLPGIA*
Coding >OphauG2|6741
ATGATGGACCCAAAGGTGGTGGAAGCCTTTGCCTCTGGCCGGCTGCCCAACCCAGAGGCGCCCAACGCAACGCCC
GAGTTTCTAAATGAGAGCCGCGACAAGCCTGCGATTATCGGGATTCTGATTGTCACGGCGCTGACGGCGACGGTG
GTGGTGGGGAGGTTGCTGTCGAGGGCGTTTGTGGTGCGGCGCTTTGGCTTTGATGATGGGCTGGCGCTGGTTTCT
CTTGTCGTCTTTGCTGCCTTTGTCGGCCTCTGCATCGAGCTTATCCGTCTCGGCTCCGGCCGCCACTTTGACTAT
ATCCAATACGTCCTCGACGTGCCCACCGTCCAGACCACCCAGGTCCTCGACTTTGCCGCGCACATTGTCTACAGC
ACGGCGCTTCTGCTCTGCCGCGTCTCGGGTCTTGCCTTTTACTACCGCGTCTGCGGCATGCACCACGGCTTCCAT
GTTGCTATCCGCGCCGTCTTTGTCATTCTCGTCGCGGCCTATCTGCCGCAGATTCTCCTCGTCATCTTCCACTGC
CGGCCCGTCACTGGCCTGTGGCCATATGGCTGGGAGCCGGGGACCGAGCAGTATGTGTGCTTGCAGTGGGGGCTG
GTGTATGTCGTGATTTCAACCATTTCGCTGTTTTGCGACTTGTTGCTGTTTGGCATTCCCGTGGCCATGCTCAAG
ATTCTGGAGATGCCGCGGCGCCGCAAGATTCAGCTGGGGTGTATTCTGCTGCCGGGTATTGCGTGA
Transcript >OphauG2|6741
ATGATGGACCCAAAGGTGGTGGAAGCCTTTGCCTCTGGCCGGCTGCCCAACCCAGAGGCGCCCAACGCAACGCCC
GAGTTTCTAAATGAGAGCCGCGACAAGCCTGCGATTATCGGGATTCTGATTGTCACGGCGCTGACGGCGACGGTG
GTGGTGGGGAGGTTGCTGTCGAGGGCGTTTGTGGTGCGGCGCTTTGGCTTTGATGATGGGCTGGCGCTGGTTTCT
CTTGTCGTCTTTGCTGCCTTTGTCGGCCTCTGCATCGAGCTTATCCGTCTCGGCTCCGGCCGCCACTTTGACTAT
ATCCAATACGTCCTCGACGTGCCCACCGTCCAGACCACCCAGGTCCTCGACTTTGCCGCGCACATTGTCTACAGC
ACGGCGCTTCTGCTCTGCCGCGTCTCGGGTCTTGCCTTTTACTACCGCGTCTGCGGCATGCACCACGGCTTCCAT
GTTGCTATCCGCGCCGTCTTTGTCATTCTCGTCGCGGCCTATCTGCCGCAGATTCTCCTCGTCATCTTCCACTGC
CGGCCCGTCACTGGCCTGTGGCCATATGGCTGGGAGCCGGGGACCGAGCAGTATGTGTGCTTGCAGTGGGGGCTG
GTGTATGTCGTGATTTCAACCATTTCGCTGTTTTGCGACTTGTTGCTGTTTGGCATTCCCGTGGCCATGCTCAAG
ATTCTGGAGATGCCGCGGCGCCGCAAGATTCAGCTGGGGTGTATTCTGCTGCCGGGTATTGCGTGA
Gene >OphauG2|6741
ATGATGGACCCAAAGGTGGTGGAAGCCTTTGCCTCTGGCCGGCTGCCCAACCCAGAGGCGCCCAACGCAACGCCC
GAGTTTCTAAATGAGAGCCGCGACAAGCCTGCGATTATCGGGATTCTGATTGTCACGGCGCTGACGGCGACGGTG
GTGGTGGGGAGGTTGCTGTCGAGGGCGTTTGTGGTGCGGCGCTTTGGCTTTGATGATGGGCTGGCGCTGGTTTCT
CTTGTGAGTCTACCCTTGTATGACAACTCGTTGTTTGCTATACTTGTCATGATGGTTGCTGCTATACTTGTCATG
ATGGTTTCTTGTATATTGCTCGCATACTGACAGATATAGGTCGTCTTTGCTGCCTTTGTCGGCCTCTGCATCGAG
CTTATCCGTCTCGGCTCCGGCCGCCACTTTGACTATATCCAATACGTCCTCGACGTGCCCACCGTCCAGACCACC
CAGGTCCTCGACTTTGCCGCGCACATTGTCTACAGCACGGCGCTTCTGCTCTGCCGCGTCTCGGGTCTTGCCTTT
TACTACCGCGTCTGCGGCATGCACCACGGCTTCCATGTTGCTATCCGCGCCGTCTTTGTCATTCTCGTCGCGGCC
TATCTGCCGCAGATTCTCCTCGTCATCTTCCACTGCCGGCCCGTCACTGGCCTGTGGCCATATGGCTGGGAGCCG
GGGACCGAGCAGTATGTGTGCTTGCAGTGGGGGCTGGTGTATGTCGTGATTTCAACCATTTCGCTGTTTTGCGAC
TTGTTGCTGTTTGGCATTCCCGTGGCCATGCTCAAGATTCTGGAGATGCCGCGGCGCCGCAAGATTCAGCTGGGG
TGTATTCTGCTGCCGGGTATTGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail