Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6733
Gene name
LocationContig_717:8557..9139
Strand+
Gene length (bp)582
Transcript length (bp)525
Coding sequence length (bp)525
Protein length (aa) 175

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00903 Glyoxalase Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 1.5E-08 14 166

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8ZM36|VIR17_SALTY Virulence protein STM3117 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=STM3117 PE=1 SV=1 11 170 2.0E-30
sp|Q28CR0|GLOD5_XENTR Glyoxalase domain-containing protein 5 OS=Xenopus tropicalis GN=glod5 PE=2 SV=1 11 174 8.0E-26
sp|Q4KLB0|GLOD5_XENLA Glyoxalase domain-containing protein 5 OS=Xenopus laevis GN=glod5 PE=2 SV=2 11 169 5.0E-25
sp|Q9D8I3|GLOD5_MOUSE Glyoxalase domain-containing protein 5 OS=Mus musculus GN=Glod5 PE=1 SV=1 14 171 9.0E-25
sp|P0C5H0|GLOD5_CANLF Glyoxalase domain-containing protein 5 OS=Canis lupus familiaris GN=GLOD5 PE=2 SV=1 11 170 1.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8ZM36|VIR17_SALTY Virulence protein STM3117 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=STM3117 PE=1 SV=1 11 170 2.0E-30
sp|Q28CR0|GLOD5_XENTR Glyoxalase domain-containing protein 5 OS=Xenopus tropicalis GN=glod5 PE=2 SV=1 11 174 8.0E-26
sp|Q4KLB0|GLOD5_XENLA Glyoxalase domain-containing protein 5 OS=Xenopus laevis GN=glod5 PE=2 SV=2 11 169 5.0E-25
sp|Q9D8I3|GLOD5_MOUSE Glyoxalase domain-containing protein 5 OS=Mus musculus GN=Glod5 PE=1 SV=1 14 171 9.0E-25
sp|P0C5H0|GLOD5_CANLF Glyoxalase domain-containing protein 5 OS=Canis lupus familiaris GN=GLOD5 PE=2 SV=1 11 170 1.0E-24
sp|Q502D1|GLOD5_DANRE Glyoxalase domain-containing protein 5 OS=Danio rerio GN=glod5 PE=2 SV=1 11 169 4.0E-24
sp|A6NK44|GLOD5_HUMAN Glyoxalase domain-containing protein 5 OS=Homo sapiens GN=GLOD5 PE=1 SV=3 5 171 5.0E-24
sp|Q54L71|GLOD5_DICDI Glyoxalase domain-containing protein 5 homolog OS=Dictyostelium discoideum GN=glod5 PE=3 SV=1 11 169 9.0E-21
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6733
MKQGTTPLAPVQDFDHLVLTCSDIAATSAWYARYLGMTPTTFTPPPLQNTPEAGLSFAESRSSCSIAKPSPSHRE
SSTRHALIFGNRKLNLHQYGREHSPRAAQPLPGTVDVCFLLAPDTDMAAVERGFRDAGIHVLEGGVVRRTGARGE
LKSVYVRDPDGNLIELSQYVNDVE*
Coding >OphauG2|6733
ATGAAACAAGGCACTACTCCGCTGGCTCCGGTCCAAGATTTCGACCACTTGGTCTTGACGTGCAGCGACATTGCC
GCCACGAGTGCGTGGTACGCGCGATACCTCGGCATGACGCCCACGACGTTTACGCCTCCACCCTTGCAGAATACC
CCTGAGGCTGGCTTGTCTTTTGCTGAGAGTAGGAGCTCGTGTTCCATTGCCAAGCCCTCTCCCTCACATCGAGAG
AGTAGCACGCGCCACGCTCTTATTTTCGGCAACCGAAAACTCAACCTCCACCAGTACGGCCGTGAGCACTCGCCT
CGGGCCGCCCAGCCTCTTCCCGGCACCGTCGACGTGTGCTTCCTGCTGGCGCCCGACACTGACATGGCAGCTGTG
GAGCGAGGCTTTAGAGATGCTGGCATCCACGTGTTGGAAGGAGGCGTAGTGCGGCGCACGGGGGCTCGGGGGGAG
CTGAAAAGCGTCTATGTGAGAGACCCAGATGGAAACTTGATAGAGCTCTCTCAATACGTAAATGACGTGGAGTAG
Transcript >OphauG2|6733
ATGAAACAAGGCACTACTCCGCTGGCTCCGGTCCAAGATTTCGACCACTTGGTCTTGACGTGCAGCGACATTGCC
GCCACGAGTGCGTGGTACGCGCGATACCTCGGCATGACGCCCACGACGTTTACGCCTCCACCCTTGCAGAATACC
CCTGAGGCTGGCTTGTCTTTTGCTGAGAGTAGGAGCTCGTGTTCCATTGCCAAGCCCTCTCCCTCACATCGAGAG
AGTAGCACGCGCCACGCTCTTATTTTCGGCAACCGAAAACTCAACCTCCACCAGTACGGCCGTGAGCACTCGCCT
CGGGCCGCCCAGCCTCTTCCCGGCACCGTCGACGTGTGCTTCCTGCTGGCGCCCGACACTGACATGGCAGCTGTG
GAGCGAGGCTTTAGAGATGCTGGCATCCACGTGTTGGAAGGAGGCGTAGTGCGGCGCACGGGGGCTCGGGGGGAG
CTGAAAAGCGTCTATGTGAGAGACCCAGATGGAAACTTGATAGAGCTCTCTCAATACGTAAATGACGTGGAGTAG
Gene >OphauG2|6733
ATGAAACAAGGCACTACTCCGCTGGCTCCGGTCCAAGATTTCGACCACTTGGTCTTGACGTGCAGCGACATTGCC
GCCACGAGTGCGTGGTACGCGCGATACCTCGGCATGACGCCCACGACGTTTACGCCTCCACCCTTGCAGAATACC
CCTGAGGCTGGCTTGTCTTTTGCTGAGAGTAGGAGCTCGTGTTCCATTGCCAAGCCCTCTCCCTCACATCGAGAG
AGTAGCACGCGCCACGCTCTTATTTTCGGCAACCGAAAACTCAACCTCCACCAGTACGGCCGTGAGCACTCGCCT
CGGGCCGCCCAGCCTCTTCCCGGCACCGTCGACGTGTGCTTCCTGCTGGCGCCCGACACTGACATGGCAGCTGTG
GAGCGAGGCTTTAGAGATGCTGGCATCCACGTGTTGGAAGGAGGCGTAGTGCGGCGCACGGGGGCTCGGGGGGAG
CTGAAAAGCGTCTATGTGAGAGACCCAGATGGAAACTTGATAGAGTAAGTGCCAAGTCACTCTAACCAGACATGT
CTTGCGCAATGAGCTAATTTGGCTAGGCTCTCTCAATACGTAAATGACGTGGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail