Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6726
Gene name
LocationContig_715:2647..6049
Strand-
Gene length (bp)3402
Transcript length (bp)3402
Coding sequence length (bp)3402
Protein length (aa) 1134

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.2E-06 604 692
PF12796 Ank_2 Ankyrin repeats (3 copies) 5.7E-08 671 760
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.1E-07 870 945
PF12796 Ank_2 Ankyrin repeats (3 copies) 4.4E-07 1050 1131
PF13637 Ank_4 Ankyrin repeats (many copies) 5.6E-05 977 1027
PF13857 Ank_5 Ankyrin repeats (many copies) 1.2E-06 1062 1116
PF00023 Ank Ankyrin repeat 2.1E-02 916 945

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 598 1096 7.0E-26
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 612 1131 5.0E-25
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 601 1069 4.0E-24
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 586 1077 2.0E-22
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 601 1086 2.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 598 1096 7.0E-26
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 612 1131 5.0E-25
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 601 1069 4.0E-24
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 586 1077 2.0E-22
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 601 1086 2.0E-22
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 601 1086 2.0E-22
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 630 1096 8.0E-22
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 586 1072 1.0E-21
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 586 1072 1.0E-21
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 630 1120 1.0E-21
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 650 1070 2.0E-21
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 630 1077 2.0E-21
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 558 1116 2.0E-21
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 558 1111 4.0E-21
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 630 1120 8.0E-21
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 558 1116 2.0E-20
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 602 1113 1.0E-19
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 615 1059 4.0E-19
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 596 1121 4.0E-19
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 596 1121 6.0E-19
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 601 1070 9.0E-19
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 602 1130 1.0E-18
sp|Q9J513|V222_FOWPN Putative ankyrin repeat protein FPV222 OS=Fowlpox virus (strain NVSL) GN=FPV222 PE=3 SV=1 609 1107 1.0E-18
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 602 1090 2.0E-18
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 602 949 7.0E-18
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 570 962 2.0E-17
sp|Q5UPF8|YL088_MIMIV Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 612 1072 4.0E-17
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 558 1129 5.0E-17
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 557 855 8.0E-17
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 582 1128 8.0E-17
sp|Q9J5H7|V024_FOWPN Putative ankyrin repeat protein FPV024 OS=Fowlpox virus (strain NVSL) GN=FPV024 PE=3 SV=1 586 1034 8.0E-17
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 617 1099 1.0E-16
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 601 1070 4.0E-16
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 558 1129 4.0E-16
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 614 1037 7.0E-16
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 571 850 7.0E-16
sp|Q91ZT7|ASB10_MOUSE Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 580 794 7.0E-16
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 614 1028 8.0E-16
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 578 1132 1.0E-15
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 602 1130 2.0E-15
sp|Q9J569|V162_FOWPN Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 612 965 4.0E-15
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 613 956 9.0E-15
sp|Q9J513|V222_FOWPN Putative ankyrin repeat protein FPV222 OS=Fowlpox virus (strain NVSL) GN=FPV222 PE=3 SV=1 571 1120 1.0E-14
sp|Q1RK13|Y220_RICBR Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 594 896 1.0E-14
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 718 1072 2.0E-14
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 623 943 3.0E-14
sp|Q9J5A7|V155_FOWPN Putative ankyrin repeat protein FPV115 OS=Fowlpox virus (strain NVSL) GN=FPV115 PE=3 SV=1 801 1072 4.0E-14
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 583 1132 7.0E-14
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 718 1131 7.0E-14
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 613 956 7.0E-14
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 623 968 9.0E-14
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 621 1106 9.0E-14
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 581 1129 1.0E-13
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 558 850 1.0E-13
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 601 1131 1.0E-13
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 616 850 1.0E-13
sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 623 968 1.0E-13
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 602 1130 2.0E-13
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 611 1132 3.0E-13
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 601 1132 3.0E-13
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 574 974 4.0E-13
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 583 1132 4.0E-13
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 566 997 4.0E-13
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 602 1131 5.0E-13
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 602 1111 6.0E-13
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 623 944 7.0E-13
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 714 1129 1.0E-12
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 558 850 1.0E-12
sp|Q96Q27|ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 736 1078 1.0E-12
sp|Q9W0T5|PYX_DROME Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 581 786 1.0E-12
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 635 1027 2.0E-12
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 602 1131 2.0E-12
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 614 935 3.0E-12
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 635 1027 4.0E-12
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 666 1074 5.0E-12
sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 801 1076 8.0E-12
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 602 1131 8.0E-12
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 581 1099 9.0E-12
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 602 1128 9.0E-12
sp|Q05823|RN5A_HUMAN 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 809 1128 9.0E-12
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 579 943 1.0E-11
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 591 945 1.0E-11
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 614 935 1.0E-11
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 714 1129 1.0E-11
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 601 1039 1.0E-11
sp|Q5UPJ9|YL122_MIMIV Putative ankyrin repeat protein L122 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L122 PE=3 SV=1 701 1070 1.0E-11
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 567 1026 1.0E-11
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 633 943 1.0E-11
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 596 1131 1.0E-11
sp|Q5UPG0|YL086_MIMIV Putative ankyrin repeat protein L86 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L86 PE=3 SV=1 612 925 1.0E-11
sp|Q5U2S6|ASB2_RAT Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 736 1078 2.0E-11
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 614 935 3.0E-11
sp|Q9J5H7|V024_FOWPN Putative ankyrin repeat protein FPV024 OS=Fowlpox virus (strain NVSL) GN=FPV024 PE=3 SV=1 840 1129 3.0E-11
sp|Q96Q27|ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 597 957 3.0E-11
sp|Q5UPJ9|YL122_MIMIV Putative ankyrin repeat protein L122 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L122 PE=3 SV=1 576 1031 3.0E-11
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 887 1132 4.0E-11
sp|Q8K0L0|ASB2_MOUSE Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 604 941 4.0E-11
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 612 956 5.0E-11
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 892 1130 5.0E-11
sp|Q5UPF8|YL088_MIMIV Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 600 1070 7.0E-11
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 602 1128 7.0E-11
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 582 986 8.0E-11
sp|Q5U2S6|ASB2_RAT Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 604 941 1.0E-10
sp|Q3SX45|ASB2_BOVIN Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 755 1103 1.0E-10
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 602 1128 2.0E-10
sp|Q8K0L0|ASB2_MOUSE Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 736 1078 2.0E-10
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 679 973 2.0E-10
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 713 1035 2.0E-10
sp|Q9J4Z6|V244_FOWPN Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 518 788 4.0E-10
sp|Q5UPG7|YL091_MIMIV Putative ankyrin repeat protein L91 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L91 PE=3 SV=1 612 1127 4.0E-10
sp|Q5R6D7|ASB8_PONAB Ankyrin repeat and SOCS box protein 8 OS=Pongo abelii GN=ASB8 PE=2 SV=1 541 731 5.0E-10
sp|Q9H765|ASB8_HUMAN Ankyrin repeat and SOCS box protein 8 OS=Homo sapiens GN=ASB8 PE=2 SV=1 541 731 5.0E-10
sp|Q9W0T5|PYX_DROME Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 650 968 6.0E-10
sp|Q08E43|ASB8_BOVIN Ankyrin repeat and SOCS box protein 8 OS=Bos taurus GN=ASB8 PE=2 SV=1 541 731 6.0E-10
sp|Q91ZT9|ASB8_MOUSE Ankyrin repeat and SOCS box protein 8 OS=Mus musculus GN=Asb8 PE=2 SV=1 541 731 7.0E-10
sp|Q9J569|V162_FOWPN Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 558 913 9.0E-10
sp|Q8VHS6|ASB15_MOUSE Ankyrin repeat and SOCS box protein 15 OS=Mus musculus GN=Asb15 PE=2 SV=2 715 1000 9.0E-10
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 574 759 1.0E-09
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 596 1113 1.0E-09
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 552 1031 1.0E-09
sp|Q9J4Z5|V245_FOWPN Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 825 1068 1.0E-09
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 554 786 1.0E-09
sp|P0C550|AKT1_ORYSI Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 602 757 1.0E-09
sp|Q8WXK1|ASB15_HUMAN Ankyrin repeat and SOCS box protein 15 OS=Homo sapiens GN=ASB15 PE=2 SV=3 715 1000 1.0E-09
sp|Q0JKV1|AKT1_ORYSJ Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 602 757 1.0E-09
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 581 855 2.0E-09
sp|Q5UPG0|YL086_MIMIV Putative ankyrin repeat protein L86 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L86 PE=3 SV=1 715 1047 2.0E-09
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 551 943 2.0E-09
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 559 760 2.0E-09
sp|Q8C6Y6|ASB14_MOUSE Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 601 943 2.0E-09
sp|Q9J503|V232_FOWPN Putative ankyrin repeat protein FPV232 OS=Fowlpox virus (strain NVSL) GN=FPV232 PE=3 SV=1 595 860 2.0E-09
sp|Q4R544|ASB8_MACFA Ankyrin repeat and SOCS box protein 8 OS=Macaca fascicularis GN=ASB8 PE=2 SV=1 541 731 2.0E-09
sp|Q8HXA6|ASB15_BOVIN Ankyrin repeat and SOCS box protein 15 OS=Bos taurus GN=ASB15 PE=2 SV=2 715 1000 2.0E-09
sp|Q8WXI3|ASB10_HUMAN Ankyrin repeat and SOCS box protein 10 OS=Homo sapiens GN=ASB10 PE=1 SV=2 601 705 2.0E-09
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 602 1113 3.0E-09
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 601 1130 3.0E-09
sp|Q1RK13|Y220_RICBR Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 669 941 3.0E-09
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 571 847 3.0E-09
sp|Q4UKX2|Y950_RICFE Putative ankyrin repeat protein RF_0950 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0950 PE=3 SV=1 567 768 3.0E-09
sp|Q810B6|ANFY1_MOUSE Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 621 1128 3.0E-09
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 586 851 4.0E-09
sp|Q1RHT6|Y997_RICBR Putative ankyrin repeat protein RBE_0997 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0997 PE=3 SV=1 602 760 4.0E-09
sp|A6NK59|ASB14_HUMAN Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 654 943 4.0E-09
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 581 855 5.0E-09
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 569 937 5.0E-09
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 609 1029 5.0E-09
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 829 1111 5.0E-09
sp|Q9FY48|KEG_ARATH E3 ubiquitin-protein ligase KEG OS=Arabidopsis thaliana GN=KEG PE=1 SV=2 613 945 5.0E-09
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 713 1029 6.0E-09
sp|Q9W0T5|PYX_DROME Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 695 1036 6.0E-09
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 787 1027 7.0E-09
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 591 938 8.0E-09
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 887 1130 8.0E-09
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 713 1129 8.0E-09
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 601 1001 9.0E-09
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 891 1129 1.0E-08
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 891 1129 1.0E-08
sp|Q9W0T5|PYX_DROME Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 620 850 1.0E-08
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 609 944 1.0E-08
sp|Q08E43|ASB8_BOVIN Ankyrin repeat and SOCS box protein 8 OS=Bos taurus GN=ASB8 PE=2 SV=1 572 734 1.0E-08
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 803 1116 2.0E-08
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 601 938 2.0E-08
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 601 1001 2.0E-08
sp|P0C550|AKT1_ORYSI Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 571 734 2.0E-08
sp|Q0JKV1|AKT1_ORYSJ Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 571 734 2.0E-08
sp|Q1RHT6|Y997_RICBR Putative ankyrin repeat protein RBE_0997 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0997 PE=3 SV=1 669 944 2.0E-08
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 605 850 2.0E-08
sp|Q9J5G9|V034_FOWPN Putative ankyrin repeat protein FPV034 OS=Fowlpox virus (strain NVSL) GN=ANK2 PE=3 SV=1 571 891 2.0E-08
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 623 858 2.0E-08
sp|Q1RK13|Y220_RICBR Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 778 1086 3.0E-08
sp|Q9J5A7|V155_FOWPN Putative ankyrin repeat protein FPV115 OS=Fowlpox virus (strain NVSL) GN=FPV115 PE=3 SV=1 571 759 3.0E-08
sp|Q91ZT9|ASB8_MOUSE Ankyrin repeat and SOCS box protein 8 OS=Mus musculus GN=Asb8 PE=2 SV=1 572 734 3.0E-08
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 566 694 3.0E-08
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 787 1027 3.0E-08
sp|Q7S3M5|AKR1_NEUCR Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 571 757 3.0E-08
sp|Q9J516|V219_FOWPN Putative ankyrin repeat protein FPV219 OS=Fowlpox virus (strain NVSL) GN=FPV219 PE=3 SV=1 602 875 4.0E-08
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 614 965 4.0E-08
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 558 760 4.0E-08
sp|A5A3E0|POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 556 753 4.0E-08
sp|Q1RHT6|Y997_RICBR Putative ankyrin repeat protein RBE_0997 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0997 PE=3 SV=1 880 1132 5.0E-08
sp|Q9J5H5|V026_FOWPN Putative ankyrin repeat protein FPV026 OS=Fowlpox virus (strain NVSL) GN=FPV026 PE=3 SV=1 777 942 5.0E-08
sp|Q6S8J3|POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 556 753 5.0E-08
sp|Q9J5A7|V155_FOWPN Putative ankyrin repeat protein FPV115 OS=Fowlpox virus (strain NVSL) GN=FPV115 PE=3 SV=1 624 933 6.0E-08
sp|Q9W0T5|PYX_DROME Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 615 848 6.0E-08
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 806 1128 6.0E-08
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 590 851 6.0E-08
sp|Q5JPF3|AN36C_HUMAN Ankyrin repeat domain-containing protein 36C OS=Homo sapiens GN=ANKRD36C PE=2 SV=3 598 753 6.0E-08
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 803 1116 6.0E-08
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 701 1027 7.0E-08
sp|P14368|V234_FOWPN Putative ankyrin repeat protein FPV234 OS=Fowlpox virus (strain NVSL) GN=FPV234 PE=3 SV=2 604 827 7.0E-08
sp|Q25338|LITD_LATTR Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 647 1131 7.0E-08
sp|Q8WWX0|ASB5_HUMAN Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens GN=ASB5 PE=2 SV=1 619 855 7.0E-08
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 713 1036 9.0E-08
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 568 1036 9.0E-08
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 601 1036 9.0E-08
sp|Q9P2R3|ANFY1_HUMAN Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 621 1128 9.0E-08
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 602 757 1.0E-07
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 602 757 1.0E-07
sp|Q1RK13|Y220_RICBR Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 588 814 1.0E-07
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 887 1070 1.0E-07
sp|Q9J516|V219_FOWPN Putative ankyrin repeat protein FPV219 OS=Fowlpox virus (strain NVSL) GN=FPV219 PE=3 SV=1 736 953 1.0E-07
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 873 1126 1.0E-07
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 567 850 1.0E-07
sp|Q8BLD6|ANR55_MOUSE Ankyrin repeat domain-containing protein 55 OS=Mus musculus GN=Ankrd55 PE=1 SV=2 562 852 1.0E-07
sp|Q09YM8|CTTB2_RABIT Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 869 1117 1.0E-07
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 601 1036 1.0E-07
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 713 1036 2.0E-07
sp|P0C550|AKT1_ORYSI Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 790 1090 2.0E-07
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 786 945 2.0E-07
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 635 855 2.0E-07
sp|Q9M8S6|SKOR_ARATH Potassium channel SKOR OS=Arabidopsis thaliana GN=SKOR PE=1 SV=1 591 757 2.0E-07
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 601 1036 2.0E-07
sp|Q17QS6|ASB5_BOVIN Ankyrin repeat and SOCS box protein 5 OS=Bos taurus GN=ASB5 PE=2 SV=1 619 850 2.0E-07
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 586 847 2.0E-07
sp|Q0JKV1|AKT1_ORYSJ Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 790 1090 3.0E-07
sp|A6NI47|POTEM_HUMAN Putative POTE ankyrin domain family member M OS=Homo sapiens GN=POTEM PE=3 SV=2 586 752 3.0E-07
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 596 851 3.0E-07
sp|Q9D1A4|ASB5_MOUSE Ankyrin repeat and SOCS box protein 5 OS=Mus musculus GN=Asb5 PE=2 SV=1 619 850 3.0E-07
sp|Q8N2N9|AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens GN=ANKRD36B PE=1 SV=4 598 753 3.0E-07
sp|Q5B0V6|AKR1_EMENI Palmitoyltransferase akr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=akr1 PE=3 SV=2 571 757 3.0E-07
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 614 855 4.0E-07
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 614 974 4.0E-07
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 559 851 4.0E-07
sp|A6NK59|ASB14_HUMAN Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 605 850 4.0E-07
sp|P14360|V240_FOWPN Putative ankyrin repeat protein FPV240 OS=Fowlpox virus (strain NVSL) GN=FPV240 PE=3 SV=1 571 817 4.0E-07
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 614 855 5.0E-07
sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 586 877 5.0E-07
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 610 787 5.0E-07
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 586 860 5.0E-07
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 586 860 5.0E-07
sp|Q923M0|PP16A_MOUSE Protein phosphatase 1 regulatory subunit 16A OS=Mus musculus GN=Ppp1r16a PE=1 SV=1 601 787 5.0E-07
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 605 1129 5.0E-07
sp|Q9J5I7|V014_FOWPN Putative ankyrin repeat protein FPV014 OS=Fowlpox virus (strain NVSL) GN=FPV014 PE=3 SV=1 908 1130 5.0E-07
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 722 1116 6.0E-07
sp|P0CG39|POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 556 753 6.0E-07
sp|Q3KP44|ANR55_HUMAN Ankyrin repeat domain-containing protein 55 OS=Homo sapiens GN=ANKRD55 PE=2 SV=3 549 831 6.0E-07
sp|P0CG38|POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 556 753 6.0E-07
sp|Q9J4Z5|V245_FOWPN Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 677 862 7.0E-07
sp|Q28BK1|HACE1_XENTR E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 554 752 7.0E-07
sp|Q7TQP6|TNI3K_RAT Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 680 948 7.0E-07
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 554 752 7.0E-07
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 707 1111 8.0E-07
sp|Q91ZT7|ASB10_MOUSE Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 731 943 8.0E-07
sp|Q4X251|AKR1_ASPFU Palmitoyltransferase akr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=akr1 PE=3 SV=2 614 757 8.0E-07
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 623 1129 8.0E-07
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 718 1129 9.0E-07
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 570 848 9.0E-07
sp|Q6S545|POTEH_HUMAN POTE ankyrin domain family member H OS=Homo sapiens GN=POTEH PE=2 SV=3 586 754 9.0E-07
sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 577 945 9.0E-07
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 602 1111 1.0E-06
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 614 851 1.0E-06
sp|Q5UPG7|YL091_MIMIV Putative ankyrin repeat protein L91 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L91 PE=3 SV=1 558 974 1.0E-06
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 586 860 1.0E-06
sp|A7E2S9|A30BL_HUMAN Putative ankyrin repeat domain-containing protein 30B-like OS=Homo sapiens GN=ANKRD30BL PE=2 SV=3 713 888 1.0E-06
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 558 760 1.0E-06
sp|B2RU33|POTEC_HUMAN POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 586 741 1.0E-06
sp|Q4R3S3|ANKR7_MACFA Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 602 735 1.0E-06
sp|A6QL64|AN36A_HUMAN Ankyrin repeat domain-containing protein 36A OS=Homo sapiens GN=ANKRD36 PE=2 SV=3 598 753 1.0E-06
sp|Q00420|GABP1_MOUSE GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 609 763 1.0E-06
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 903 1130 2.0E-06
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 887 1103 2.0E-06
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 739 1120 2.0E-06
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 600 877 2.0E-06
sp|Q8K0L0|ASB2_MOUSE Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 581 863 2.0E-06
sp|Q3SX45|ASB2_BOVIN Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 591 908 2.0E-06
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 717 948 2.0E-06
sp|Q8C6Y6|ASB14_MOUSE Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 794 1103 2.0E-06
sp|P14368|V234_FOWPN Putative ankyrin repeat protein FPV234 OS=Fowlpox virus (strain NVSL) GN=FPV234 PE=3 SV=2 571 787 2.0E-06
sp|A6NGH8|ANR61_HUMAN Ankyrin repeat domain-containing protein 61 OS=Homo sapiens GN=ANKRD61 PE=3 SV=2 608 760 2.0E-06
sp|Q60649|CLPB_MOUSE Caseinolytic peptidase B protein homolog OS=Mus musculus GN=Clpb PE=1 SV=1 789 934 2.0E-06
sp|Q9J517|V218_FOWPN Putative ankyrin repeat protein FPV218 OS=Fowlpox virus (strain NVSL) GN=FPV218 PE=3 SV=1 803 1027 2.0E-06
sp|Q5UPX1|YL289_MIMIV Putative ankyrin repeat protein L289 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L289 PE=3 SV=1 625 923 2.0E-06
sp|Q8GXE6|AKT6_ARATH Potassium channel AKT6 OS=Arabidopsis thaliana GN=AKT6 PE=1 SV=2 617 761 2.0E-06
sp|Q9SCX5|AKT5_ARATH Probable potassium channel AKT5 OS=Arabidopsis thaliana GN=AKT5 PE=2 SV=2 617 761 2.0E-06
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 623 852 2.0E-06
sp|Q9D504|ANKR7_MOUSE Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 614 753 2.0E-06
sp|Q54BA2|Y3800_DICDI Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 612 765 2.0E-06
sp|Q9J4Z4|V246_FOWPN Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 808 1031 2.0E-06
sp|Q1RMI3|GABP1_BOVIN GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 609 763 2.0E-06
sp|Q38998|AKT1_ARATH Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 664 826 2.0E-06
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 724 1118 3.0E-06
sp|Q5UPG0|YL086_MIMIV Putative ankyrin repeat protein L86 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L86 PE=3 SV=1 724 947 3.0E-06
sp|Q9J5I7|V014_FOWPN Putative ankyrin repeat protein FPV014 OS=Fowlpox virus (strain NVSL) GN=FPV014 PE=3 SV=1 706 945 3.0E-06
sp|Q8GXE6|AKT6_ARATH Potassium channel AKT6 OS=Arabidopsis thaliana GN=AKT6 PE=1 SV=2 827 1047 3.0E-06
sp|Q9J5H8|V023_FOWPN Putative ankyrin repeat protein FPV023 OS=Fowlpox virus (strain NVSL) GN=FPV023 PE=3 SV=1 576 740 3.0E-06
sp|Q6AFL2|Y958_LEIXX Putative ankyrin-containing lipoprotein Lxx09580 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=Lxx09580 PE=3 SV=2 610 760 3.0E-06
sp|Q06547|GABP1_HUMAN GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 609 763 3.0E-06
sp|Q6S8J7|POTEA_HUMAN POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 601 761 3.0E-06
sp|Q2IBF8|CTTB2_EULMM Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 869 1117 3.0E-06
sp|Q5RF15|TNI3K_PONAB Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 601 855 3.0E-06
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 601 848 4.0E-06
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 887 1130 4.0E-06
sp|Q9J569|V162_FOWPN Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 774 1130 4.0E-06
sp|Q5U2S6|ASB2_RAT Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 591 863 4.0E-06
sp|Q3SX45|ASB2_BOVIN Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 826 1071 4.0E-06
sp|Q9FY48|KEG_ARATH E3 ubiquitin-protein ligase KEG OS=Arabidopsis thaliana GN=KEG PE=1 SV=2 612 786 4.0E-06
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 569 759 4.0E-06
sp|Q5E9N5|CLPB_BOVIN Caseinolytic peptidase B protein homolog OS=Bos taurus GN=CLPB PE=2 SV=1 789 934 4.0E-06
sp|Q4I8B6|AKR1_GIBZE Palmitoyltransferase AKR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=AKR1 PE=3 SV=1 571 757 4.0E-06
sp|Q804S5|MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 808 1048 4.0E-06
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 718 1128 5.0E-06
sp|Q9J517|V218_FOWPN Putative ankyrin repeat protein FPV218 OS=Fowlpox virus (strain NVSL) GN=FPV218 PE=3 SV=1 570 848 5.0E-06
sp|Q5RF15|TNI3K_PONAB Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 676 948 5.0E-06
sp|Q9J508|V227_FOWPN Putative ankyrin repeat protein FPV227 OS=Fowlpox virus (strain NVSL) GN=FPV227 PE=3 SV=1 797 936 5.0E-06
sp|O90760|V031_FOWPN Putative ankyrin repeat protein FPV031 OS=Fowlpox virus (strain NVSL) GN=ANK3 PE=3 SV=1 630 760 5.0E-06
sp|Q59H18|TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 676 948 5.0E-06
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 707 1111 6.0E-06
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 887 1111 6.0E-06
sp|Q38998|AKT1_ARATH Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 617 759 6.0E-06
sp|Q5GIG6|TNI3K_MOUSE Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 680 948 6.0E-06
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 569 752 6.0E-06
sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 635 945 6.0E-06
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 727 1049 7.0E-06
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 586 860 7.0E-06
sp|P0CG39|POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 586 741 7.0E-06
sp|P0CG38|POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 586 741 7.0E-06
sp|Q9J5H8|V023_FOWPN Putative ankyrin repeat protein FPV023 OS=Fowlpox virus (strain NVSL) GN=FPV023 PE=3 SV=1 777 945 7.0E-06
sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 618 819 7.0E-06
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 586 877 8.0E-06
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 887 1129 9.0E-06
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 869 1117 9.0E-06
sp|O75762|TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 703 1129 9.0E-06
sp|Q9J513|V222_FOWPN Putative ankyrin repeat protein FPV222 OS=Fowlpox virus (strain NVSL) GN=FPV222 PE=3 SV=1 887 1130 1.0E-05
sp|Q1RK13|Y220_RICBR Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 558 688 1.0E-05
sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 869 1117 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3725
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6726 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4627
Ophiocordyceps camponoti-floridani Ophcf2|02887
Ophiocordyceps camponoti-rufipedis Ophun1|1811
Ophiocordyceps kimflemingae Ophio5|5707
Ophiocordyceps subramaniannii Hirsu2|7269

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6726
MSFLSLDLPQDRTSRAHDSSQAPTLPPQESLTLDLKEALGLLPSTPSTLSPTTSRVVPGRDAPPGPAPKPSNQSL
AHNSHSYHDTTFSQRPSQNPLYQQSNHSASSRALSTHRESSHHSPSPRGYSPAPPRGYSPSARLSSTGSSAGVHK
TPPASFPARGPPPSFPAGHQQDLHRVVSAKSTYSQGRSHRPHDIAEEPALPPFLPLVAEHTRMNMTSSNKAQSQC
LHLCKNIAAAGDQVAERMAEYSSLVKHLPHGFDQLANELLDACQVLFYIEAGLEEAVRTAHPLPLEMVTVLEKRF
RAAQADFRVLDQMVNKFLEYERRGAMGRMRRGFGKMFGDSGIEKMKLALQKRREDLKMSALMFQWNLGTDKIETE
PGIGYIGLAAVLDDSNLRRSRNESLVGINDDKNSVHRSIPSRHQSHHESQHEDARLANAHHGQPLPLLPPTKDDH
LGPFSPESTSGESSHFTQTNSDMSAGSPTTRYTVSSTTSSYDGHVGHKKANMQDRRGTYVDETLEPPRENSREMD
ALLADINNLDLDSTKVVNLKSEPFDMPRRRPRSNVDAEKHGSKHALVSAVRVSDHKSMMQLLDRGVSPNTGAEAH
ALNEAVSIQDSESVRVLLLYGADPNEPDGDGVSPLVAAAEKSFLSAAAALLKYGADPNLTTDPDLETPLAVATIA
NNVRLAHLMLMYGGNPNSITAERNTLLISCINKKTPAKLVDLLLGYGADPNDKNHEGKTALFEAITCGRADIVTS
LLENKANPNLPGPKHMLWPSTHQPACLKVLLAHGADFRKAPGIMELATSINQMESIGILLKAGVDPNAKKDGVYT
PLCSSIRDNRPDIFHLLLSSGADPNLPASEYPAFKCVTHNRVQFLPALVAAGAKLNSPKGILETAVTSNNGEALR
WLLDQGLDPDEKNSKGHTALTSAIRDNRLNFVETLLKRGANPNIRGQDWPVCMAVRHPEILKRILTVLPEPRAFK
GVLEMAVVANQIESIKLLLAAGVSVEDRNGGVFSPLTSAIREHRTEIVRFLIEQGGADVNAPGEHLPIVKGLRRC
AAGDEASIIDLLLDNGADPNKVYRGWNGIMQALENGDPDMLRKLCEKSGVNVDVRDDNGRTVTEIAVSRRWEEAV
SIMLDNAM*
Coding >OphauG2|6726
ATGAGCTTTCTGTCCCTTGATCTGCCCCAAGACAGAACCAGTCGAGCCCACGACTCCTCCCAAGCTCCTACTCTT
CCCCCCCAAGAATCACTCACCCTGGATCTCAAGGAGGCTCTGGGCTTGCTCCCCTCGACCCCGAGCACCCTTTCG
CCCACTACATCGAGAGTCGTCCCGGGTCGCGACGCCCCGCCTGGGCCTGCTCCCAAGCCCTCCAACCAAAGCCTC
GCCCACAACTCTCACTCCTACCACGACACCACCTTTTCGCAGAGGCCCTCTCAGAACCCGCTCTATCAACAGTCC
AACCATTCCGCCTCGTCGCGTGCTCTCTCCACCCATCGAGAGTCCAGCCACCACTCCCCTTCGCCGCGCGGTTAC
TCGCCTGCGCCGCCCCGGGGTTACTCGCCTTCGGCCCGCCTCTCGTCGACCGGCTCGTCGGCTGGCGTGCATAAA
ACCCCCCCCGCCTCTTTCCCTGCTCGCGGCCCGCCCCCATCGTTTCCTGCTGGCCACCAGCAAGACTTGCATCGA
GTCGTCTCGGCAAAGTCGACCTACTCGCAAGGACGCTCCCATCGGCCTCACGACATTGCCGAGGAGCCTGCCCTG
CCGCCCTTTTTGCCCCTGGTTGCTGAACACACCCGCATGAACATGACATCGTCCAACAAGGCCCAGTCGCAATGC
CTTCACCTCTGCAAAAACATTGCCGCCGCCGGTGACCAGGTCGCCGAGCGCATGGCTGAGTACTCATCCCTTGTC
AAGCACCTGCCACATGGCTTTGACCAGCTGGCCAATGAGTTGCTCGATGCCTGCCAGGTCCTGTTTTACATTGAA
GCTGGCCTGGAAGAGGCTGTCCGCACCGCTCACCCTCTGCCTCTTGAGATGGTGACGGTGCTGGAAAAGCGATTC
CGTGCGGCCCAGGCCGATTTCCGAGTCCTCGACCAAATGGTCAACAAATTCCTCGAGTATGAGCGTAGAGGAGCC
ATGGGACGCATGCGCCGCGGCTTTGGCAAGATGTTTGGAGACAGTGGCATTGAAAAGATGAAGCTGGCGCTGCAA
AAGAGGCGCGAAGACCTCAAGATGAGTGCTCTCATGTTCCAGTGGAATCTGGGCACCGACAAGATTGAGACGGAG
CCCGGCATTGGCTATATTGGCCTCGCTGCTGTTCTCGACGACTCCAATCTTCGCCGCAGCCGCAATGAGTCTCTG
GTTGGAATCAATGATGACAAGAATTCGGTTCATCGATCCATTCCCTCCCGCCATCAAAGCCACCATGAGAGCCAA
CACGAAGACGCACGTCTCGCCAACGCTCACCATGGCCAGCCTCTGCCTCTGCTTCCACCTACCAAGGATGACCAC
CTGGGGCCCTTTAGCCCCGAATCGACAAGCGGCGAGAGCAGCCACTTTACTCAAACCAACTCGGACATGAGCGCT
GGCAGCCCGACAACGCGATACACCGTCAGCTCAACAACAAGCTCGTACGACGGCCATGTCGGTCACAAAAAGGCA
AACATGCAAGATCGTCGTGGCACCTATGTTGATGAGACCCTTGAGCCACCTCGTGAGAATAGCCGTGAGATGGAC
GCTCTCCTGGCCGACATCAACAATCTGGACCTCGACAGCACCAAGGTGGTCAATCTCAAGAGCGAGCCCTTTGAC
ATGCCGCGTCGCCGGCCTCGCAGCAACGTTGACGCTGAGAAGCACGGGTCCAAGCACGCCCTTGTCTCGGCTGTT
CGCGTCTCCGATCACAAGTCCATGATGCAGCTGCTTGACCGCGGCGTATCGCCCAACACGGGAGCCGAGGCTCAC
GCGCTCAATGAGGCCGTGTCTATACAGGACAGCGAGAGTGTGCGCGTTTTGCTTCTCTATGGCGCCGACCCCAAT
GAGCCAGACGGTGACGGAGTCAGCCCTCTTGTGGCCGCGGCCGAAAAGTCCTTTCTGTCGGCTGCTGCTGCCCTG
CTCAAGTATGGCGCGGATCCCAACCTCACTACCGATCCGGATCTGGAGACGCCTCTGGCAGTGGCCACCATTGCC
AACAATGTCCGTCTGGCACACTTGATGCTCATGTATGGCGGCAACCCCAACTCGATAACAGCAGAGCGCAACACG
CTCCTCATCAGCTGCATCAACAAGAAGACGCCGGCCAAGCTTGTCGACCTGCTGCTGGGCTATGGCGCGGATCCC
AACGACAAGAACCACGAGGGCAAGACGGCGCTCTTTGAGGCCATTACCTGCGGGAGAGCCGACATTGTGACGAGT
CTGCTGGAGAACAAGGCCAACCCCAACCTGCCAGGCCCCAAGCACATGCTCTGGCCATCGACACACCAGCCCGCC
TGCCTCAAGGTGTTGCTGGCTCACGGCGCCGACTTCCGCAAAGCCCCTGGCATCATGGAGCTGGCAACCAGCATC
AACCAGATGGAGTCGATTGGCATCCTTCTCAAGGCAGGCGTGGATCCCAATGCCAAAAAGGACGGTGTGTACACG
CCGTTGTGCTCGTCAATCCGTGACAACCGGCCCGACATCTTCCACCTGCTGCTCTCGAGCGGGGCTGATCCCAAC
CTGCCGGCCAGTGAGTATCCGGCCTTCAAGTGCGTGACGCACAACCGGGTACAGTTCTTGCCGGCACTTGTTGCG
GCTGGAGCCAAGCTCAACTCGCCCAAGGGTATCCTTGAGACGGCTGTCACATCCAACAATGGGGAAGCGCTGCGA
TGGCTCCTCGACCAGGGCCTGGACCCCGATGAGAAGAACTCCAAGGGACACACGGCCCTGACCAGTGCCATCCGC
GACAACCGCCTCAACTTTGTCGAGACGCTGCTCAAGCGCGGAGCCAACCCCAACATTCGCGGGCAAGACTGGCCC
GTTTGCATGGCGGTGCGCCACCCCGAGATCCTCAAGCGCATTCTCACGGTGCTGCCCGAGCCGCGCGCCTTCAAG
GGCGTGTTGGAAATGGCAGTCGTGGCCAACCAGATCGAGTCCATCAAGCTGCTGCTGGCGGCGGGAGTGTCGGTC
GAGGATCGCAACGGCGGCGTCTTCTCGCCCCTGACGTCGGCCATTCGCGAGCACCGGACCGAGATTGTGCGTTTC
CTCATTGAGCAGGGCGGTGCCGACGTCAATGCTCCTGGCGAGCATCTTCCCATTGTCAAGGGCCTGCGCCGGTGC
GCGGCGGGCGATGAGGCCAGCATCATTGACCTGCTGCTCGACAACGGCGCCGACCCCAACAAGGTCTACCGTGGC
TGGAACGGCATTATGCAGGCGCTGGAGAATGGAGACCCCGACATGCTGCGTAAGCTGTGCGAGAAGTCGGGGGTT
AATGTCGACGTCAGGGACGACAACGGCCGAACCGTCACCGAGATTGCCGTGTCGAGGCGCTGGGAGGAGGCTGTA
AGCATCATGCTCGACAATGCCATGTAG
Transcript >OphauG2|6726
ATGAGCTTTCTGTCCCTTGATCTGCCCCAAGACAGAACCAGTCGAGCCCACGACTCCTCCCAAGCTCCTACTCTT
CCCCCCCAAGAATCACTCACCCTGGATCTCAAGGAGGCTCTGGGCTTGCTCCCCTCGACCCCGAGCACCCTTTCG
CCCACTACATCGAGAGTCGTCCCGGGTCGCGACGCCCCGCCTGGGCCTGCTCCCAAGCCCTCCAACCAAAGCCTC
GCCCACAACTCTCACTCCTACCACGACACCACCTTTTCGCAGAGGCCCTCTCAGAACCCGCTCTATCAACAGTCC
AACCATTCCGCCTCGTCGCGTGCTCTCTCCACCCATCGAGAGTCCAGCCACCACTCCCCTTCGCCGCGCGGTTAC
TCGCCTGCGCCGCCCCGGGGTTACTCGCCTTCGGCCCGCCTCTCGTCGACCGGCTCGTCGGCTGGCGTGCATAAA
ACCCCCCCCGCCTCTTTCCCTGCTCGCGGCCCGCCCCCATCGTTTCCTGCTGGCCACCAGCAAGACTTGCATCGA
GTCGTCTCGGCAAAGTCGACCTACTCGCAAGGACGCTCCCATCGGCCTCACGACATTGCCGAGGAGCCTGCCCTG
CCGCCCTTTTTGCCCCTGGTTGCTGAACACACCCGCATGAACATGACATCGTCCAACAAGGCCCAGTCGCAATGC
CTTCACCTCTGCAAAAACATTGCCGCCGCCGGTGACCAGGTCGCCGAGCGCATGGCTGAGTACTCATCCCTTGTC
AAGCACCTGCCACATGGCTTTGACCAGCTGGCCAATGAGTTGCTCGATGCCTGCCAGGTCCTGTTTTACATTGAA
GCTGGCCTGGAAGAGGCTGTCCGCACCGCTCACCCTCTGCCTCTTGAGATGGTGACGGTGCTGGAAAAGCGATTC
CGTGCGGCCCAGGCCGATTTCCGAGTCCTCGACCAAATGGTCAACAAATTCCTCGAGTATGAGCGTAGAGGAGCC
ATGGGACGCATGCGCCGCGGCTTTGGCAAGATGTTTGGAGACAGTGGCATTGAAAAGATGAAGCTGGCGCTGCAA
AAGAGGCGCGAAGACCTCAAGATGAGTGCTCTCATGTTCCAGTGGAATCTGGGCACCGACAAGATTGAGACGGAG
CCCGGCATTGGCTATATTGGCCTCGCTGCTGTTCTCGACGACTCCAATCTTCGCCGCAGCCGCAATGAGTCTCTG
GTTGGAATCAATGATGACAAGAATTCGGTTCATCGATCCATTCCCTCCCGCCATCAAAGCCACCATGAGAGCCAA
CACGAAGACGCACGTCTCGCCAACGCTCACCATGGCCAGCCTCTGCCTCTGCTTCCACCTACCAAGGATGACCAC
CTGGGGCCCTTTAGCCCCGAATCGACAAGCGGCGAGAGCAGCCACTTTACTCAAACCAACTCGGACATGAGCGCT
GGCAGCCCGACAACGCGATACACCGTCAGCTCAACAACAAGCTCGTACGACGGCCATGTCGGTCACAAAAAGGCA
AACATGCAAGATCGTCGTGGCACCTATGTTGATGAGACCCTTGAGCCACCTCGTGAGAATAGCCGTGAGATGGAC
GCTCTCCTGGCCGACATCAACAATCTGGACCTCGACAGCACCAAGGTGGTCAATCTCAAGAGCGAGCCCTTTGAC
ATGCCGCGTCGCCGGCCTCGCAGCAACGTTGACGCTGAGAAGCACGGGTCCAAGCACGCCCTTGTCTCGGCTGTT
CGCGTCTCCGATCACAAGTCCATGATGCAGCTGCTTGACCGCGGCGTATCGCCCAACACGGGAGCCGAGGCTCAC
GCGCTCAATGAGGCCGTGTCTATACAGGACAGCGAGAGTGTGCGCGTTTTGCTTCTCTATGGCGCCGACCCCAAT
GAGCCAGACGGTGACGGAGTCAGCCCTCTTGTGGCCGCGGCCGAAAAGTCCTTTCTGTCGGCTGCTGCTGCCCTG
CTCAAGTATGGCGCGGATCCCAACCTCACTACCGATCCGGATCTGGAGACGCCTCTGGCAGTGGCCACCATTGCC
AACAATGTCCGTCTGGCACACTTGATGCTCATGTATGGCGGCAACCCCAACTCGATAACAGCAGAGCGCAACACG
CTCCTCATCAGCTGCATCAACAAGAAGACGCCGGCCAAGCTTGTCGACCTGCTGCTGGGCTATGGCGCGGATCCC
AACGACAAGAACCACGAGGGCAAGACGGCGCTCTTTGAGGCCATTACCTGCGGGAGAGCCGACATTGTGACGAGT
CTGCTGGAGAACAAGGCCAACCCCAACCTGCCAGGCCCCAAGCACATGCTCTGGCCATCGACACACCAGCCCGCC
TGCCTCAAGGTGTTGCTGGCTCACGGCGCCGACTTCCGCAAAGCCCCTGGCATCATGGAGCTGGCAACCAGCATC
AACCAGATGGAGTCGATTGGCATCCTTCTCAAGGCAGGCGTGGATCCCAATGCCAAAAAGGACGGTGTGTACACG
CCGTTGTGCTCGTCAATCCGTGACAACCGGCCCGACATCTTCCACCTGCTGCTCTCGAGCGGGGCTGATCCCAAC
CTGCCGGCCAGTGAGTATCCGGCCTTCAAGTGCGTGACGCACAACCGGGTACAGTTCTTGCCGGCACTTGTTGCG
GCTGGAGCCAAGCTCAACTCGCCCAAGGGTATCCTTGAGACGGCTGTCACATCCAACAATGGGGAAGCGCTGCGA
TGGCTCCTCGACCAGGGCCTGGACCCCGATGAGAAGAACTCCAAGGGACACACGGCCCTGACCAGTGCCATCCGC
GACAACCGCCTCAACTTTGTCGAGACGCTGCTCAAGCGCGGAGCCAACCCCAACATTCGCGGGCAAGACTGGCCC
GTTTGCATGGCGGTGCGCCACCCCGAGATCCTCAAGCGCATTCTCACGGTGCTGCCCGAGCCGCGCGCCTTCAAG
GGCGTGTTGGAAATGGCAGTCGTGGCCAACCAGATCGAGTCCATCAAGCTGCTGCTGGCGGCGGGAGTGTCGGTC
GAGGATCGCAACGGCGGCGTCTTCTCGCCCCTGACGTCGGCCATTCGCGAGCACCGGACCGAGATTGTGCGTTTC
CTCATTGAGCAGGGCGGTGCCGACGTCAATGCTCCTGGCGAGCATCTTCCCATTGTCAAGGGCCTGCGCCGGTGC
GCGGCGGGCGATGAGGCCAGCATCATTGACCTGCTGCTCGACAACGGCGCCGACCCCAACAAGGTCTACCGTGGC
TGGAACGGCATTATGCAGGCGCTGGAGAATGGAGACCCCGACATGCTGCGTAAGCTGTGCGAGAAGTCGGGGGTT
AATGTCGACGTCAGGGACGACAACGGCCGAACCGTCACCGAGATTGCCGTGTCGAGGCGCTGGGAGGAGGCTGTA
AGCATCATGCTCGACAATGCCATGTAG
Gene >OphauG2|6726
ATGAGCTTTCTGTCCCTTGATCTGCCCCAAGACAGAACCAGTCGAGCCCACGACTCCTCCCAAGCTCCTACTCTT
CCCCCCCAAGAATCACTCACCCTGGATCTCAAGGAGGCTCTGGGCTTGCTCCCCTCGACCCCGAGCACCCTTTCG
CCCACTACATCGAGAGTCGTCCCGGGTCGCGACGCCCCGCCTGGGCCTGCTCCCAAGCCCTCCAACCAAAGCCTC
GCCCACAACTCTCACTCCTACCACGACACCACCTTTTCGCAGAGGCCCTCTCAGAACCCGCTCTATCAACAGTCC
AACCATTCCGCCTCGTCGCGTGCTCTCTCCACCCATCGAGAGTCCAGCCACCACTCCCCTTCGCCGCGCGGTTAC
TCGCCTGCGCCGCCCCGGGGTTACTCGCCTTCGGCCCGCCTCTCGTCGACCGGCTCGTCGGCTGGCGTGCATAAA
ACCCCCCCCGCCTCTTTCCCTGCTCGCGGCCCGCCCCCATCGTTTCCTGCTGGCCACCAGCAAGACTTGCATCGA
GTCGTCTCGGCAAAGTCGACCTACTCGCAAGGACGCTCCCATCGGCCTCACGACATTGCCGAGGAGCCTGCCCTG
CCGCCCTTTTTGCCCCTGGTTGCTGAACACACCCGCATGAACATGACATCGTCCAACAAGGCCCAGTCGCAATGC
CTTCACCTCTGCAAAAACATTGCCGCCGCCGGTGACCAGGTCGCCGAGCGCATGGCTGAGTACTCATCCCTTGTC
AAGCACCTGCCACATGGCTTTGACCAGCTGGCCAATGAGTTGCTCGATGCCTGCCAGGTCCTGTTTTACATTGAA
GCTGGCCTGGAAGAGGCTGTCCGCACCGCTCACCCTCTGCCTCTTGAGATGGTGACGGTGCTGGAAAAGCGATTC
CGTGCGGCCCAGGCCGATTTCCGAGTCCTCGACCAAATGGTCAACAAATTCCTCGAGTATGAGCGTAGAGGAGCC
ATGGGACGCATGCGCCGCGGCTTTGGCAAGATGTTTGGAGACAGTGGCATTGAAAAGATGAAGCTGGCGCTGCAA
AAGAGGCGCGAAGACCTCAAGATGAGTGCTCTCATGTTCCAGTGGAATCTGGGCACCGACAAGATTGAGACGGAG
CCCGGCATTGGCTATATTGGCCTCGCTGCTGTTCTCGACGACTCCAATCTTCGCCGCAGCCGCAATGAGTCTCTG
GTTGGAATCAATGATGACAAGAATTCGGTTCATCGATCCATTCCCTCCCGCCATCAAAGCCACCATGAGAGCCAA
CACGAAGACGCACGTCTCGCCAACGCTCACCATGGCCAGCCTCTGCCTCTGCTTCCACCTACCAAGGATGACCAC
CTGGGGCCCTTTAGCCCCGAATCGACAAGCGGCGAGAGCAGCCACTTTACTCAAACCAACTCGGACATGAGCGCT
GGCAGCCCGACAACGCGATACACCGTCAGCTCAACAACAAGCTCGTACGACGGCCATGTCGGTCACAAAAAGGCA
AACATGCAAGATCGTCGTGGCACCTATGTTGATGAGACCCTTGAGCCACCTCGTGAGAATAGCCGTGAGATGGAC
GCTCTCCTGGCCGACATCAACAATCTGGACCTCGACAGCACCAAGGTGGTCAATCTCAAGAGCGAGCCCTTTGAC
ATGCCGCGTCGCCGGCCTCGCAGCAACGTTGACGCTGAGAAGCACGGGTCCAAGCACGCCCTTGTCTCGGCTGTT
CGCGTCTCCGATCACAAGTCCATGATGCAGCTGCTTGACCGCGGCGTATCGCCCAACACGGGAGCCGAGGCTCAC
GCGCTCAATGAGGCCGTGTCTATACAGGACAGCGAGAGTGTGCGCGTTTTGCTTCTCTATGGCGCCGACCCCAAT
GAGCCAGACGGTGACGGAGTCAGCCCTCTTGTGGCCGCGGCCGAAAAGTCCTTTCTGTCGGCTGCTGCTGCCCTG
CTCAAGTATGGCGCGGATCCCAACCTCACTACCGATCCGGATCTGGAGACGCCTCTGGCAGTGGCCACCATTGCC
AACAATGTCCGTCTGGCACACTTGATGCTCATGTATGGCGGCAACCCCAACTCGATAACAGCAGAGCGCAACACG
CTCCTCATCAGCTGCATCAACAAGAAGACGCCGGCCAAGCTTGTCGACCTGCTGCTGGGCTATGGCGCGGATCCC
AACGACAAGAACCACGAGGGCAAGACGGCGCTCTTTGAGGCCATTACCTGCGGGAGAGCCGACATTGTGACGAGT
CTGCTGGAGAACAAGGCCAACCCCAACCTGCCAGGCCCCAAGCACATGCTCTGGCCATCGACACACCAGCCCGCC
TGCCTCAAGGTGTTGCTGGCTCACGGCGCCGACTTCCGCAAAGCCCCTGGCATCATGGAGCTGGCAACCAGCATC
AACCAGATGGAGTCGATTGGCATCCTTCTCAAGGCAGGCGTGGATCCCAATGCCAAAAAGGACGGTGTGTACACG
CCGTTGTGCTCGTCAATCCGTGACAACCGGCCCGACATCTTCCACCTGCTGCTCTCGAGCGGGGCTGATCCCAAC
CTGCCGGCCAGTGAGTATCCGGCCTTCAAGTGCGTGACGCACAACCGGGTACAGTTCTTGCCGGCACTTGTTGCG
GCTGGAGCCAAGCTCAACTCGCCCAAGGGTATCCTTGAGACGGCTGTCACATCCAACAATGGGGAAGCGCTGCGA
TGGCTCCTCGACCAGGGCCTGGACCCCGATGAGAAGAACTCCAAGGGACACACGGCCCTGACCAGTGCCATCCGC
GACAACCGCCTCAACTTTGTCGAGACGCTGCTCAAGCGCGGAGCCAACCCCAACATTCGCGGGCAAGACTGGCCC
GTTTGCATGGCGGTGCGCCACCCCGAGATCCTCAAGCGCATTCTCACGGTGCTGCCCGAGCCGCGCGCCTTCAAG
GGCGTGTTGGAAATGGCAGTCGTGGCCAACCAGATCGAGTCCATCAAGCTGCTGCTGGCGGCGGGAGTGTCGGTC
GAGGATCGCAACGGCGGCGTCTTCTCGCCCCTGACGTCGGCCATTCGCGAGCACCGGACCGAGATTGTGCGTTTC
CTCATTGAGCAGGGCGGTGCCGACGTCAATGCTCCTGGCGAGCATCTTCCCATTGTCAAGGGCCTGCGCCGGTGC
GCGGCGGGCGATGAGGCCAGCATCATTGACCTGCTGCTCGACAACGGCGCCGACCCCAACAAGGTCTACCGTGGC
TGGAACGGCATTATGCAGGCGCTGGAGAATGGAGACCCCGACATGCTGCGTAAGCTGTGCGAGAAGTCGGGGGTT
AATGTCGACGTCAGGGACGACAACGGCCGAACCGTCACCGAGATTGCCGTGTCGAGGCGCTGGGAGGAGGCTGTA
AGCATCATGCTCGACAATGCCATGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail