Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6722
Gene name
LocationContig_714:2119..3244
Strand+
Gene length (bp)1125
Transcript length (bp)1062
Coding sequence length (bp)1062
Protein length (aa) 354

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01764 Lipase_3 Lipase (class 3) 2.2E-34 120 250
PF06259 Abhydrolase_8 Alpha/beta hydrolase 1.4E-04 176 250

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59952|LIP_THELA Lipase OS=Thermomyces lanuginosus GN=LIP PE=1 SV=1 63 311 1.0E-44
sp|P61869|MDLA_PENCY Mono- and diacylglycerol lipase OS=Penicillium cyclopium GN=mdlA PE=3 SV=1 51 304 2.0E-43
sp|P61870|MDLA_PENCA Mono- and diacylglycerol lipase OS=Penicillium camembertii GN=mdlA PE=1 SV=1 51 304 2.0E-43
sp|Q2UNW5|FAEA_ASPOR Probable feruloyl esterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=faeA PE=3 SV=1 67 304 2.0E-29
sp|B8NIB8|FAEA_ASPFN Probable feruloyl esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=faeA PE=3 SV=2 103 304 4.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59952|LIP_THELA Lipase OS=Thermomyces lanuginosus GN=LIP PE=1 SV=1 63 311 1.0E-44
sp|P61869|MDLA_PENCY Mono- and diacylglycerol lipase OS=Penicillium cyclopium GN=mdlA PE=3 SV=1 51 304 2.0E-43
sp|P61870|MDLA_PENCA Mono- and diacylglycerol lipase OS=Penicillium camembertii GN=mdlA PE=1 SV=1 51 304 2.0E-43
sp|Q2UNW5|FAEA_ASPOR Probable feruloyl esterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=faeA PE=3 SV=1 67 304 2.0E-29
sp|B8NIB8|FAEA_ASPFN Probable feruloyl esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=faeA PE=3 SV=2 103 304 4.0E-29
sp|Q9P979|FAEA_ASPAW Feruloyl esterase A OS=Aspergillus awamori GN=faeA PE=1 SV=3 103 304 6.0E-28
sp|Q0CBM7|FAEA_ASPTN Probable feruloyl esterase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=faeA PE=3 SV=1 67 304 7.0E-28
sp|A2QSY5|FAEA_ASPNC Probable feruloyl esterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=faeA PE=3 SV=1 55 304 1.0E-27
sp|O42807|FAEA_ASPNG Feruloyl esterase A OS=Aspergillus niger GN=faeA PE=1 SV=1 55 304 3.0E-27
sp|P19515|LIP_RHIMI Lipase OS=Rhizomucor miehei PE=1 SV=2 46 304 6.0E-26
sp|P61872|LIP_RHIOR Lipase OS=Rhizopus oryzae PE=1 SV=1 46 311 1.0E-25
sp|P61871|LIP_RHINI Lipase OS=Rhizopus niveus PE=1 SV=1 46 311 1.0E-25
sp|O42815|FAEA_ASPTU Feruloyl esterase A OS=Aspergillus tubingensis GN=faeA PE=3 SV=1 103 304 2.0E-24
sp|Q9XTR8|LIP1_CAEEL Lipase ZK262.3 OS=Caenorhabditis elegans GN=ZK262.3 PE=1 SV=1 97 248 3.0E-14
sp|P47145|YJ77_YEAST Putative lipase YJR107W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJR107W PE=3 SV=2 108 313 2.0E-10
sp|Q8S1D9|EG1_ORYSJ Phospholipase A1 EG1, chloroplastic OS=Oryza sativa subsp. japonica GN=EG1 PE=1 SV=1 108 248 6.0E-09
sp|A2WY00|EG1_ORYSI Phospholipase A1 EG1, chloroplastic OS=Oryza sativa subsp. indica GN=EG1 PE=3 SV=1 108 248 6.0E-09
sp|Q9MA46|PLA12_ARATH Galactolipase DONGLE, chloroplastic OS=Arabidopsis thaliana GN=DGL PE=1 SV=1 108 264 6.0E-08
sp|Q7M4U7|LIP_RHIJA Lipase (Fragments) OS=Rhizopus javanicus PE=1 SV=2 211 305 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6722
MKLHLLLALGAVVHGYLSPRPIRFSKPRPGWSQPLPTAAINPLFDIVTANQVSVNERATMAYYSEHSLAAYCNMF
KKPGEYISCKAKCPSIQDRVIIHATFEQTGIGGYIAIDHLRHEIVVSFRGSTNIRNYLTDLQFGWSRCHLVPNCL
VHSGFLYAWNDASTIVQSSIVLIRSHHPSYSLVFTGHSLGGAVATLAAAHLYHDAHISSIVFTYGSPRVGNAAFA
AYAQRAARNWRVTHANDIVPRLPLLEWGFRHVETEYWLPGDGFGRPYAPPEMRRCEGEMALRCNSGTTGLDIMAH
LVYFHNMVSCMELKIRWRRESQFENLTQFLDLEDKVAEWERIDREFAMNGRHL*
Coding >OphauG2|6722
ATGAAACTCCATCTCCTCTTAGCCCTCGGCGCCGTCGTCCACGGCTATCTAAGCCCCAGGCCAATCCGGTTTTCC
AAACCCCGTCCAGGTTGGTCTCAACCGCTCCCAACGGCGGCCATCAACCCCCTTTTTGACATTGTAACAGCAAAC
CAAGTTTCAGTCAATGAGCGTGCCACCATGGCGTATTACTCTGAACACTCGCTTGCTGCGTACTGCAACATGTTC
AAGAAACCTGGAGAATACATTAGCTGCAAAGCAAAATGCCCTTCAATACAGGATCGCGTCATTATCCATGCTACT
TTCGAGCAAACTGGAATCGGGGGCTACATCGCCATTGACCACTTGCGCCATGAAATCGTCGTCTCGTTCCGTGGT
AGCACCAACATTCGCAACTACCTCACCGATCTCCAATTCGGCTGGTCCAGATGCCATCTCGTCCCCAACTGCCTC
GTCCACAGCGGCTTCCTCTACGCCTGGAACGACGCCTCCACCATTGTCCAGTCCTCCATTGTCCTCATCCGCTCC
CACCATCCCTCCTACTCCCTCGTCTTCACCGGCCACTCCCTCGGCGGCGCCGTTGCCACCCTTGCCGCCGCCCAT
CTCTACCACGACGCTCACATCTCCTCCATCGTCTTTACCTATGGCTCTCCGCGCGTCGGAAACGCTGCTTTCGCC
GCCTATGCCCAAAGAGCCGCTCGCAACTGGCGCGTCACTCATGCAAACGACATCGTCCCCAGACTCCCGCTGCTG
GAATGGGGCTTCCGCCACGTCGAGACCGAGTACTGGCTTCCCGGCGATGGCTTTGGCAGGCCTTATGCGCCGCCC
GAAATGCGCCGGTGCGAGGGGGAAATGGCGCTGCGCTGCAACTCGGGAACCACCGGGCTTGACATCATGGCACAT
CTGGTTTACTTTCACAACATGGTGTCGTGTATGGAGTTGAAAATACGGTGGAGGCGAGAATCCCAATTCGAAAAT
CTTACCCAGTTTCTTGATTTAGAGGACAAGGTGGCTGAGTGGGAGCGTATCGACCGCGAGTTTGCAATGAATGGG
CGTCACCTCTAA
Transcript >OphauG2|6722
ATGAAACTCCATCTCCTCTTAGCCCTCGGCGCCGTCGTCCACGGCTATCTAAGCCCCAGGCCAATCCGGTTTTCC
AAACCCCGTCCAGGTTGGTCTCAACCGCTCCCAACGGCGGCCATCAACCCCCTTTTTGACATTGTAACAGCAAAC
CAAGTTTCAGTCAATGAGCGTGCCACCATGGCGTATTACTCTGAACACTCGCTTGCTGCGTACTGCAACATGTTC
AAGAAACCTGGAGAATACATTAGCTGCAAAGCAAAATGCCCTTCAATACAGGATCGCGTCATTATCCATGCTACT
TTCGAGCAAACTGGAATCGGGGGCTACATCGCCATTGACCACTTGCGCCATGAAATCGTCGTCTCGTTCCGTGGT
AGCACCAACATTCGCAACTACCTCACCGATCTCCAATTCGGCTGGTCCAGATGCCATCTCGTCCCCAACTGCCTC
GTCCACAGCGGCTTCCTCTACGCCTGGAACGACGCCTCCACCATTGTCCAGTCCTCCATTGTCCTCATCCGCTCC
CACCATCCCTCCTACTCCCTCGTCTTCACCGGCCACTCCCTCGGCGGCGCCGTTGCCACCCTTGCCGCCGCCCAT
CTCTACCACGACGCTCACATCTCCTCCATCGTCTTTACCTATGGCTCTCCGCGCGTCGGAAACGCTGCTTTCGCC
GCCTATGCCCAAAGAGCCGCTCGCAACTGGCGCGTCACTCATGCAAACGACATCGTCCCCAGACTCCCGCTGCTG
GAATGGGGCTTCCGCCACGTCGAGACCGAGTACTGGCTTCCCGGCGATGGCTTTGGCAGGCCTTATGCGCCGCCC
GAAATGCGCCGGTGCGAGGGGGAAATGGCGCTGCGCTGCAACTCGGGAACCACCGGGCTTGACATCATGGCACAT
CTGGTTTACTTTCACAACATGGTGTCGTGTATGGAGTTGAAAATACGGTGGAGGCGAGAATCCCAATTCGAAAAT
CTTACCCAGTTTCTTGATTTAGAGGACAAGGTGGCTGAGTGGGAGCGTATCGACCGCGAGTTTGCAATGAATGGG
CGTCACCTCTAA
Gene >OphauG2|6722
ATGAAACTCCATCTCCTCTTAGCCCTCGGCGCCGTCGTCCACGGCTATCTAAGCCCCAGGCCAATCCGGTTTTCC
AAACCCCGTCCAGGTTGGTCTCAACCGCTCCCAACGGCGGCCATCAACCCCCTTTTTGACATTGTAACAGCAAAC
CAAGTTTCAGTCAATGAGCGTGCCACCATGGCGTATTACTCTGAACACTCGCTTGCTGCGTACTGCAACATGTTC
AAGAAACCTGGAGAATACATTAGCTGCAAAGCAAAATGCCCTTCAATACAGGATCGCGTCATTATCCATGCTACT
TTCGAGCAAGTTACTCTTCTTGAGCCGGCGGCAGTGCGTGACTAACCCGGCTCAAAACACAGAGGCCAAAAGACT
GGAATCGGGGGCTACATCGCCATTGACCACTTGCGCCATGAAATCGTCGTCTCGTTCCGTGGTAGCACCAACATT
CGCAACTACCTCACCGATCTCCAATTCGGCTGGTCCAGATGCCATCTCGTCCCCAACTGCCTCGTCCACAGCGGC
TTCCTCTACGCCTGGAACGACGCCTCCACCATTGTCCAGTCCTCCATTGTCCTCATCCGCTCCCACCATCCCTCC
TACTCCCTCGTCTTCACCGGCCACTCCCTCGGCGGCGCCGTTGCCACCCTTGCCGCCGCCCATCTCTACCACGAC
GCTCACATCTCCTCCATCGTCTTTACCTATGGCTCTCCGCGCGTCGGAAACGCTGCTTTCGCCGCCTATGCCCAA
AGAGCCGCTCGCAACTGGCGCGTCACTCATGCAAACGACATCGTCCCCAGACTCCCGCTGCTGGAATGGGGCTTC
CGCCACGTCGAGACCGAGTACTGGCTTCCCGGCGATGGCTTTGGCAGGCCTTATGCGCCGCCCGAAATGCGCCGG
TGCGAGGGGGAAATGGCGCTGCGCTGCAACTCGGGAACCACCGGGCTTGACATCATGGCACATCTGGTTTACTTT
CACAACATGGTGTCGTGTATGGAGTTGAAAATACGGTGGAGGCGAGAATCCCAATTCGAAAATCTTACCCAGTTT
CTTGATTTAGAGGACAAGGTGGCTGAGTGGGAGCGTATCGACCGCGAGTTTGCAATGAATGGGCGTCACCTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail