Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|672
Gene name
LocationContig_117:13701..14598
Strand-
Gene length (bp)897
Transcript length (bp)747
Coding sequence length (bp)747
Protein length (aa) 249

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08590 DUF1771 Domain of unknown function (DUF1771) 2.5E-25 31 94
PF01713 Smr Smr domain 2.0E-08 104 161

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UTP4|YLL3_SCHPO Smr domain-containing protein C11H11.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11H11.03c PE=3 SV=1 30 248 5.0E-35
sp|Q08954|YP199_YEAST Smr domain-containing protein YPL199C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL199C PE=1 SV=1 24 209 2.0E-30
sp|Q86UW6|N4BP2_HUMAN NEDD4-binding protein 2 OS=Homo sapiens GN=N4BP2 PE=1 SV=2 30 154 3.0E-13
sp|O64843|CID7_ARATH Polyadenylate-binding protein-interacting protein 7 OS=Arabidopsis thaliana GN=CID7 PE=1 SV=1 12 145 4.0E-11

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|672
MLNRDAMATPRTRLGGRALHSGDNEAVEREYDRLRDLARAEAEKRNSCFDRSRQAYQAGDGAAAKDLSNQGKRHD
SKMDELNRQASDYIFRENNAPGKVSGDEIDLHGQFVEEAERILEQRIRADQAAGQTHLHAIVGKGIHSAGHVQKI
KPKVEQLCRELGLKCRTEENAGRIYINLQGGEAVPPPPSSHQQQQQQQQQHHHGQQQQQHHGQQQQQQHGQQDDI
AKIVDKLLPRVLRKLEKACCAVM*
Coding >OphauG2|672
ATGCTCAATCGCGACGCGATGGCGACGCCTAGGACGAGGCTGGGCGGGCGAGCGCTGCACTCTGGCGACAATGAG
GCTGTCGAGCGCGAATACGACCGGCTTCGCGACCTGGCGCGTGCCGAGGCCGAGAAGCGCAATTCTTGCTTTGAC
CGATCGCGGCAGGCCTACCAAGCGGGCGACGGCGCCGCAGCCAAGGACCTGTCCAACCAGGGAAAGCGGCACGAC
TCCAAGATGGATGAGCTGAACCGCCAGGCCTCGGACTACATTTTCCGCGAGAATAACGCGCCGGGCAAAGTCTCG
GGCGACGAGATTGATTTGCACGGGCAGTTTGTCGAAGAGGCCGAGCGCATCCTCGAGCAGCGCATCCGTGCCGAC
CAGGCCGCGGGCCAGACACATCTACACGCCATTGTTGGCAAGGGCATTCACTCGGCCGGCCATGTGCAAAAGATT
AAGCCCAAGGTCGAACAGCTGTGCCGCGAGCTGGGGCTCAAGTGTCGCACCGAGGAGAATGCGGGCAGGATTTAT
ATCAATTTGCAGGGAGGAGAAGCCGTGCCGCCACCGCCGTCGTCGCATCAACAGCAGCAGCAGCAGCAGCAGCAG
CATCATCATGGCCAGCAGCAGCAGCAGCATCATGGCCAGCAGCAACAGCAGCAGCATGGCCAGCAAGACGACATT
GCCAAGATTGTCGACAAGCTCCTCCCCCGCGTCCTGCGCAAACTTGAAAAGGCCTGCTGCGCCGTCATGTAA
Transcript >OphauG2|672
ATGCTCAATCGCGACGCGATGGCGACGCCTAGGACGAGGCTGGGCGGGCGAGCGCTGCACTCTGGCGACAATGAG
GCTGTCGAGCGCGAATACGACCGGCTTCGCGACCTGGCGCGTGCCGAGGCCGAGAAGCGCAATTCTTGCTTTGAC
CGATCGCGGCAGGCCTACCAAGCGGGCGACGGCGCCGCAGCCAAGGACCTGTCCAACCAGGGAAAGCGGCACGAC
TCCAAGATGGATGAGCTGAACCGCCAGGCCTCGGACTACATTTTCCGCGAGAATAACGCGCCGGGCAAAGTCTCG
GGCGACGAGATTGATTTGCACGGGCAGTTTGTCGAAGAGGCCGAGCGCATCCTCGAGCAGCGCATCCGTGCCGAC
CAGGCCGCGGGCCAGACACATCTACACGCCATTGTTGGCAAGGGCATTCACTCGGCCGGCCATGTGCAAAAGATT
AAGCCCAAGGTCGAACAGCTGTGCCGCGAGCTGGGGCTCAAGTGTCGCACCGAGGAGAATGCGGGCAGGATTTAT
ATCAATTTGCAGGGAGGAGAAGCCGTGCCGCCACCGCCGTCGTCGCATCAACAGCAGCAGCAGCAGCAGCAGCAG
CATCATCATGGCCAGCAGCAGCAGCAGCATCATGGCCAGCAGCAACAGCAGCAGCATGGCCAGCAAGACGACATT
GCCAAGATTGTCGACAAGCTCCTCCCCCGCGTCCTGCGCAAACTTGAAAAGGCCTGCTGCGCCGTCATGTAA
Gene >OphauG2|672
ATGCTCAATCGCGACGCGATGGCGACGCCTAGGACGAGGCTGGGCGGGCGAGGTGCGTGATGCTGGCCTGCTGTA
GATGTTTACGGGGCAGAGGGCACAAGAAGTAGTGGATTGACTTGATGCAACGGCAGCGCTGCACTCTGGCGACAA
TGAGGCTGTCGAGCGCGAATACGACCGGCTTCGCGACCTGGCGCGTGCCGAGGCCGAGAAGCGCAATTCTTGCTT
TGACCGAGTACGTGGCGCTCTATTTGTCTTGCAACTGGGCCGTGAGGCTAATTTGAAGCTCTTGGCGGCCAACGT
CAGTCGCGGCAGGCCTACCAAGCGGGCGACGGCGCCGCAGCCAAGGACCTGTCCAACCAGGGAAAGCGGCACGAC
TCCAAGATGGATGAGCTGAACCGCCAGGCCTCGGACTACATTTTCCGCGAGAATAACGCGCCGGGCAAAGTCTCG
GGCGACGAGATTGATTTGCACGGGCAGTTTGTCGAAGAGGCCGAGCGCATCCTCGAGCAGCGCATCCGTGCCGAC
CAGGCCGCGGGCCAGACACATCTACACGCCATTGTTGGCAAGGGCATTCACTCGGCCGGCCATGTGCAAAAGATT
AAGCCCAAGGTCGAACAGCTGTGCCGCGAGCTGGGGCTCAAGTGTCGCACCGAGGAGAATGCGGGCAGGATTTAT
ATCAATTTGCAGGGAGGAGAAGCCGTGCCGCCACCGCCGTCGTCGCATCAACAGCAGCAGCAGCAGCAGCAGCAG
CATCATCATGGCCAGCAGCAGCAGCAGCATCATGGCCAGCAGCAACAGCAGCAGCATGGCCAGCAAGACGACATT
GCCAAGATTGTCGACAAGCTCCTCCCCCGCGTCCTGCGCAAACTTGAAAAGGCCTGCTGCGCCGTCATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail