Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6704
Gene name
LocationContig_71:29850..31292
Strand-
Gene length (bp)1442
Transcript length (bp)1356
Coding sequence length (bp)1356
Protein length (aa) 452

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00190 Cupin_1 Cupin 8.0E-18 121 252
PF00190 Cupin_1 Cupin 9.5E-20 296 407
PF07883 Cupin_2 Cupin domain 1.2E-10 146 218
PF07883 Cupin_2 Cupin domain 1.9E-13 326 399

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O34714|OXDC_BACSU Oxalate decarboxylase OxdC OS=Bacillus subtilis (strain 168) GN=oxdC PE=1 SV=1 70 430 3.0E-150
sp|O34767|OXDD_BACSU Oxalate decarboxylase OxdD OS=Bacillus subtilis (strain 168) GN=oxdD PE=1 SV=1 70 428 3.0E-133
sp|D4AKL6|OXDD_ARTBC Probable oxalate decarboxylase ARB_04859 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04859 PE=1 SV=1 74 420 9.0E-91
sp|D4B179|OXDC_ARTBC Oxalate decarboxylase ARB_02208 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02208 PE=1 SV=1 74 420 5.0E-86
sp|O34767|OXDD_BACSU Oxalate decarboxylase OxdD OS=Bacillus subtilis (strain 168) GN=oxdD PE=1 SV=1 124 261 8.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O34714|OXDC_BACSU Oxalate decarboxylase OxdC OS=Bacillus subtilis (strain 168) GN=oxdC PE=1 SV=1 70 430 3.0E-150
sp|O34767|OXDD_BACSU Oxalate decarboxylase OxdD OS=Bacillus subtilis (strain 168) GN=oxdD PE=1 SV=1 70 428 3.0E-133
sp|D4AKL6|OXDD_ARTBC Probable oxalate decarboxylase ARB_04859 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04859 PE=1 SV=1 74 420 9.0E-91
sp|D4B179|OXDC_ARTBC Oxalate decarboxylase ARB_02208 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02208 PE=1 SV=1 74 420 5.0E-86
sp|O34767|OXDD_BACSU Oxalate decarboxylase OxdD OS=Bacillus subtilis (strain 168) GN=oxdD PE=1 SV=1 124 261 8.0E-16
sp|D4B179|OXDC_ARTBC Oxalate decarboxylase ARB_02208 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02208 PE=1 SV=1 119 266 4.0E-13
sp|D4AKL6|OXDD_ARTBC Probable oxalate decarboxylase ARB_04859 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04859 PE=1 SV=1 119 264 5.0E-11
sp|Q6I544|GL52_ORYSJ Germin-like protein 5-1 OS=Oryza sativa subsp. japonica GN=Os05g0277500 PE=2 SV=1 321 441 3.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6704
MKLSPCQLLLASLCSALPHNDSPRQRLLNGLPLHAKFSRASDAAAVNPYTPSFRDPYDNKVDAIRLHVDPLPWRN
GHGASVLGPYNRQRSRQSPDLIRPPSTDHGDVQNMRWSFTDSHVRIEEGGWTRQTTLRELPSSVELAGVNMRLGP
SVIRELHWHKEAEWAYVLDGQVRITALDYEGGSFFDDLKKGDLWYFPSGVPHSLQGLGDNGTEFLLIFDDGRFSE
ESTFLLTDWLAHTPKSVIAENFNLAPQVFDHLPKSEKYIFQGSKPGSIDQERPKGKGVKKSAYNFTHRMLDQEPR
KTSGGQVRITDSTNFPISKTVAAAHLIIEPGALREMHWHPNADEWSFFISGRARVTVFAAEGKARTFDYMAGDVG
IVPKNMGHFVENIGDEPVEMLEIFRADQFRDFSLFQWMGETPQRMVLDHLFAGDDEAGQQFLDKIKDANKDEIRS
Y*
Coding >OphauG2|6704
ATGAAGCTCTCCCCGTGCCAGCTGCTCCTCGCCAGCCTCTGCTCCGCCCTGCCGCACAATGACAGCCCGCGACAA
CGGCTGCTCAACGGGCTGCCGCTACACGCAAAGTTCAGCAGAGCCAGCGACGCGGCCGCCGTCAACCCCTACACG
CCCAGCTTCCGCGACCCCTACGACAACAAGGTCGATGCCATCCGCCTCCACGTCGATCCCCTGCCCTGGCGCAAC
GGCCACGGCGCCTCGGTGCTGGGCCCCTACAACCGCCAACGCTCGCGCCAGAGCCCCGACCTCATCCGCCCGCCC
AGCACCGACCACGGCGACGTGCAAAACATGCGATGGAGCTTCACCGACTCGCACGTGCGCATCGAGGAGGGCGGC
TGGACGCGCCAGACCACGCTGCGTGAGCTGCCCTCGAGCGTCGAGCTGGCCGGCGTCAACATGCGCCTCGGCCCA
TCAGTCATTCGCGAGCTGCACTGGCACAAAGAGGCCGAATGGGCCTATGTCCTGGATGGCCAGGTGCGCATCACC
GCCCTCGACTATGAGGGCGGCAGCTTCTTTGACGATTTGAAAAAGGGCGACTTGTGGTATTTCCCCAGCGGCGTC
CCGCATTCGCTGCAGGGCCTGGGCGACAACGGCACAGAGTTCCTCCTCATCTTTGACGACGGCCGCTTTTCCGAG
GAGTCGACCTTTTTGCTGACCGACTGGCTGGCCCACACGCCCAAGTCGGTCATTGCCGAAAACTTCAACCTTGCC
CCCCAAGTCTTTGACCACTTGCCCAAGAGCGAAAAGTACATTTTCCAAGGCTCCAAACCCGGCTCCATCGACCAG
GAGCGCCCCAAGGGCAAGGGCGTCAAGAAGTCGGCCTACAACTTTACCCACCGCATGCTGGACCAGGAGCCCCGC
AAGACGAGCGGCGGCCAGGTGCGCATCACCGACTCAACCAACTTTCCCATATCAAAGACGGTGGCCGCCGCTCAC
CTCATTATCGAACCCGGCGCCCTGCGCGAAATGCACTGGCACCCCAATGCCGACGAATGGTCCTTTTTCATCAGC
GGCCGTGCCCGCGTCACCGTCTTTGCCGCCGAGGGCAAGGCCCGCACCTTTGACTACATGGCCGGCGACGTGGGC
ATCGTTCCCAAGAACATGGGCCACTTTGTCGAGAACATTGGCGACGAGCCCGTCGAGATGCTCGAGATTTTCCGC
GCCGACCAGTTTCGCGACTTTTCCCTCTTCCAGTGGATGGGCGAGACGCCCCAGCGCATGGTGCTTGACCACCTC
TTTGCCGGCGATGACGAGGCCGGCCAGCAATTCTTGGACAAGATTAAGGATGCCAACAAGGATGAAATCCGGAGC
TACTAA
Transcript >OphauG2|6704
ATGAAGCTCTCCCCGTGCCAGCTGCTCCTCGCCAGCCTCTGCTCCGCCCTGCCGCACAATGACAGCCCGCGACAA
CGGCTGCTCAACGGGCTGCCGCTACACGCAAAGTTCAGCAGAGCCAGCGACGCGGCCGCCGTCAACCCCTACACG
CCCAGCTTCCGCGACCCCTACGACAACAAGGTCGATGCCATCCGCCTCCACGTCGATCCCCTGCCCTGGCGCAAC
GGCCACGGCGCCTCGGTGCTGGGCCCCTACAACCGCCAACGCTCGCGCCAGAGCCCCGACCTCATCCGCCCGCCC
AGCACCGACCACGGCGACGTGCAAAACATGCGATGGAGCTTCACCGACTCGCACGTGCGCATCGAGGAGGGCGGC
TGGACGCGCCAGACCACGCTGCGTGAGCTGCCCTCGAGCGTCGAGCTGGCCGGCGTCAACATGCGCCTCGGCCCA
TCAGTCATTCGCGAGCTGCACTGGCACAAAGAGGCCGAATGGGCCTATGTCCTGGATGGCCAGGTGCGCATCACC
GCCCTCGACTATGAGGGCGGCAGCTTCTTTGACGATTTGAAAAAGGGCGACTTGTGGTATTTCCCCAGCGGCGTC
CCGCATTCGCTGCAGGGCCTGGGCGACAACGGCACAGAGTTCCTCCTCATCTTTGACGACGGCCGCTTTTCCGAG
GAGTCGACCTTTTTGCTGACCGACTGGCTGGCCCACACGCCCAAGTCGGTCATTGCCGAAAACTTCAACCTTGCC
CCCCAAGTCTTTGACCACTTGCCCAAGAGCGAAAAGTACATTTTCCAAGGCTCCAAACCCGGCTCCATCGACCAG
GAGCGCCCCAAGGGCAAGGGCGTCAAGAAGTCGGCCTACAACTTTACCCACCGCATGCTGGACCAGGAGCCCCGC
AAGACGAGCGGCGGCCAGGTGCGCATCACCGACTCAACCAACTTTCCCATATCAAAGACGGTGGCCGCCGCTCAC
CTCATTATCGAACCCGGCGCCCTGCGCGAAATGCACTGGCACCCCAATGCCGACGAATGGTCCTTTTTCATCAGC
GGCCGTGCCCGCGTCACCGTCTTTGCCGCCGAGGGCAAGGCCCGCACCTTTGACTACATGGCCGGCGACGTGGGC
ATCGTTCCCAAGAACATGGGCCACTTTGTCGAGAACATTGGCGACGAGCCCGTCGAGATGCTCGAGATTTTCCGC
GCCGACCAGTTTCGCGACTTTTCCCTCTTCCAGTGGATGGGCGAGACGCCCCAGCGCATGGTGCTTGACCACCTC
TTTGCCGGCGATGACGAGGCCGGCCAGCAATTCTTGGACAAGATTAAGGATGCCAACAAGGATGAAATCCGGAGC
TACTAA
Gene >OphauG2|6704
ATGAAGCTCTCCCCGTGCCAGCTGCTCCTCGCCAGCCTCTGCTCCGCCCTGCCGCACAATGACAGCCCGCGACAA
CGGCTGCTCAACGGGCTGCCGCTACACGCAAAGTTCAGCAGAGCCAGCGACGCGGCCGCCGTCAACCCCTACACG
CCCAGCTTCCGCGACCCCTACGACAACAAGGTCGATGCCATCCGCCTCCACGTCGATCCCCTGCCCTGGCGCAAC
GGCCACGGCGCCTCGGTGCTGGGCCCCTACAACCGCCAACGCTCGCGCCAGAGCCCCGACCTCATCCGCCCGCCC
AGCACCGACCACGGCGACGTGCAAAACATGCGATGGAGCTTCACCGACTCGCACGTGCGCATCGAGGAGGGCGGC
TGGACGCGCCAGACCACGCTGCGTGAGCTGCCCTCGAGCGTCGAGCTGGCCGGCGTCAACATGCGCCTCGGCCCA
TCAGTCATTCGCGAGCTGCACTGGCACAAAGAGGCCGAATGGGCCTATGTCCTGGATGGCCAGGTGCGCATCACC
GCCCTCGACTATGAGGGCGGCAGCTTCTTTGACGATTTGAAAAAGGGCGACTTGTGGTATTTCCCCAGCGGCGTC
CCGCATTCGCTGCAGGGCCTGGGCGACAACGGCACAGAGTTCCTCCTCATCTTTGACGACGGCCGCTTTTCCGAG
GAGTCGACCTTTTTGCTGACCGACTGGCTGGGTGAGCAGTCTTGCCCCCGTCTTGTTTTGGTTGCCCACACTGCC
GCATTGTCTCGTGGCCCCGACTAACACACCACTCTTGTCCAGCCCACACGCCCAAGTCGGTCATTGCCGAAAACT
TCAACCTTGCCCCCCAAGTCTTTGACCACTTGCCCAAGAGCGAAAAGTACATTTTCCAAGGCTCCAAACCCGGCT
CCATCGACCAGGAGCGCCCCAAGGGCAAGGGCGTCAAGAAGTCGGCCTACAACTTTACCCACCGCATGCTGGACC
AGGAGCCCCGCAAGACGAGCGGCGGCCAGGTGCGCATCACCGACTCAACCAACTTTCCCATATCAAAGACGGTGG
CCGCCGCTCACCTCATTATCGAACCCGGCGCCCTGCGCGAAATGCACTGGCACCCCAATGCCGACGAATGGTCCT
TTTTCATCAGCGGCCGTGCCCGCGTCACCGTCTTTGCCGCCGAGGGCAAGGCCCGCACCTTTGACTACATGGCCG
GCGACGTGGGCATCGTTCCCAAGAACATGGGCCACTTTGTCGAGAACATTGGCGACGAGCCCGTCGAGATGCTCG
AGATTTTCCGCGCCGACCAGTTTCGCGACTTTTCCCTCTTCCAGTGGATGGGCGAGACGCCCCAGCGCATGGTGC
TTGACCACCTCTTTGCCGGCGATGACGAGGCCGGCCAGCAATTCTTGGACAAGATTAAGGATGCCAACAAGGATG
AAATCCGGAGCTACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail