Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|670
Gene name
LocationContig_117:10578..11642
Strand-
Gene length (bp)1064
Transcript length (bp)1005
Coding sequence length (bp)1005
Protein length (aa) 335

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08433 KTI12 Chromatin associated protein KTI12 2.9E-71 1 327
PF13671 AAA_33 AAA domain 4.1E-06 3 154

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7V4|KTI12_SCHPO Protein kti12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kti12 PE=3 SV=1 1 334 3.0E-57
sp|P34253|KTI12_YEAST Protein KTI12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTI12 PE=1 SV=2 1 302 3.0E-41
sp|Q4KLF3|KTI12_XENLA Protein KTI12 homolog OS=Xenopus laevis GN=kti12 PE=2 SV=1 1 330 1.0E-40
sp|Q0P457|KTI12_DANRE Protein KTI12 homolog OS=Danio rerio GN=kti12 PE=2 SV=2 1 330 9.0E-38
sp|Q9LMH0|KTI12_ARATH Protein KTI12 homolog OS=Arabidopsis thaliana GN=KTI12 PE=1 SV=1 1 330 3.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7V4|KTI12_SCHPO Protein kti12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kti12 PE=3 SV=1 1 334 3.0E-57
sp|P34253|KTI12_YEAST Protein KTI12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTI12 PE=1 SV=2 1 302 3.0E-41
sp|Q4KLF3|KTI12_XENLA Protein KTI12 homolog OS=Xenopus laevis GN=kti12 PE=2 SV=1 1 330 1.0E-40
sp|Q0P457|KTI12_DANRE Protein KTI12 homolog OS=Danio rerio GN=kti12 PE=2 SV=2 1 330 9.0E-38
sp|Q9LMH0|KTI12_ARATH Protein KTI12 homolog OS=Arabidopsis thaliana GN=KTI12 PE=1 SV=1 1 330 3.0E-30
sp|Q9D1R2|KTI12_MOUSE Protein KTI12 homolog OS=Mus musculus GN=Kti12 PE=1 SV=1 1 330 5.0E-25
sp|B9GAG9|KTI12_ORYSJ Protein KTI12 homolog OS=Oryza sativa subsp. japonica GN=KTI12 PE=3 SV=1 1 327 1.0E-23
sp|B8BK80|KTI12_ORYSI Protein KTI12 homolog OS=Oryza sativa subsp. indica GN=OsI_35919 PE=3 SV=2 1 327 1.0E-23
sp|Q96EK9|KTI12_HUMAN Protein KTI12 homolog OS=Homo sapiens GN=KTI12 PE=1 SV=1 1 124 4.0E-17
sp|Q148I5|KTI12_BOVIN Protein KTI12 homolog OS=Bos taurus GN=KTI12 PE=2 SV=1 1 124 1.0E-16
sp|Q5I0L7|KTI12_RAT Protein KTI12 homolog OS=Rattus norvegicus GN=Kti12 PE=1 SV=1 1 124 9.0E-16
sp|Q5I0L7|KTI12_RAT Protein KTI12 homolog OS=Rattus norvegicus GN=Kti12 PE=1 SV=1 161 330 1.0E-08
sp|Q148I5|KTI12_BOVIN Protein KTI12 homolog OS=Bos taurus GN=KTI12 PE=2 SV=1 143 330 2.0E-08
sp|Q96EK9|KTI12_HUMAN Protein KTI12 homolog OS=Homo sapiens GN=KTI12 PE=1 SV=1 145 330 9.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|670
MPLIIVTGLPTSGKSTRAKQLHQYLLKRVPDPKRLHIVSDDLLSISRSVYDLSPSKLAAHTRSANASEKDARAAL
YAAVKRQLSDKDFVILDSLNYIKGWRYQLHCEAKAVCTPSCLLQVACSRHQARQVNEQRLQRRHGHDDKAEHDQE
HGDDSCHVEPYEPDNWDNLVFRYEEPNPMTRWDSPLFALVWDDDAEQTTKTFDALWDAIAGQGRRIIRPNQATVQ
RGRDADGDYLYLLDRETQHVVKCILGHQQNVDGAGGLVKIALNGAEKEHAIVELPPDKRLGLPQLQRLRRAFIGL
NRGGIGLESVGNMAIDGLREAFVRYLNDAFEEGD*
Coding >OphauG2|670
ATGCCGCTCATCATCGTCACCGGCCTCCCCACCTCAGGCAAATCAACGCGTGCAAAACAGCTTCATCAATATCTG
CTGAAACGCGTCCCCGATCCCAAGCGTCTGCACATTGTATCCGACGACTTGCTGTCCATATCCAGAAGTGTCTAT
GACCTCTCGCCTTCCAAACTCGCCGCCCACACACGCTCTGCCAATGCCTCAGAAAAGGACGCCCGCGCTGCCCTA
TACGCCGCCGTCAAACGCCAGCTCTCGGACAAGGACTTCGTCATTCTAGACAGCCTCAACTATATCAAAGGTTGG
CGCTACCAGCTGCATTGCGAGGCCAAGGCGGTGTGCACTCCGAGCTGCCTCTTGCAAGTTGCATGTTCCCGCCAT
CAAGCTAGACAGGTCAATGAGCAACGGCTGCAAAGACGCCATGGCCATGATGACAAGGCAGAACACGATCAAGAG
CACGGCGACGATTCTTGCCATGTTGAGCCATATGAGCCTGACAATTGGGATAACCTCGTCTTCCGCTACGAGGAA
CCCAATCCCATGACACGCTGGGATAGCCCCCTCTTTGCTCTTGTATGGGACGACGACGCGGAGCAAACAACAAAG
ACATTCGACGCTCTTTGGGACGCAATTGCAGGCCAAGGACGCCGCATCATCCGTCCTAATCAGGCCACAGTTCAA
CGTGGACGCGATGCCGACGGTGATTACCTCTACCTTCTCGACCGCGAAACCCAACATGTTGTCAAGTGCATTCTC
GGCCACCAACAAAACGTCGATGGTGCTGGAGGATTAGTCAAAATAGCACTGAACGGTGCCGAGAAAGAACATGCC
ATTGTGGAGCTCCCCCCCGACAAAAGGCTCGGCCTACCGCAGCTGCAGCGGCTCAGAAGAGCATTCATTGGTCTG
AATAGAGGTGGCATTGGCCTTGAGTCTGTGGGTAATATGGCAATTGATGGCCTGAGGGAAGCCTTTGTTCGTTAT
CTCAACGACGCTTTCGAAGAGGGCGACTAG
Transcript >OphauG2|670
ATGCCGCTCATCATCGTCACCGGCCTCCCCACCTCAGGCAAATCAACGCGTGCAAAACAGCTTCATCAATATCTG
CTGAAACGCGTCCCCGATCCCAAGCGTCTGCACATTGTATCCGACGACTTGCTGTCCATATCCAGAAGTGTCTAT
GACCTCTCGCCTTCCAAACTCGCCGCCCACACACGCTCTGCCAATGCCTCAGAAAAGGACGCCCGCGCTGCCCTA
TACGCCGCCGTCAAACGCCAGCTCTCGGACAAGGACTTCGTCATTCTAGACAGCCTCAACTATATCAAAGGTTGG
CGCTACCAGCTGCATTGCGAGGCCAAGGCGGTGTGCACTCCGAGCTGCCTCTTGCAAGTTGCATGTTCCCGCCAT
CAAGCTAGACAGGTCAATGAGCAACGGCTGCAAAGACGCCATGGCCATGATGACAAGGCAGAACACGATCAAGAG
CACGGCGACGATTCTTGCCATGTTGAGCCATATGAGCCTGACAATTGGGATAACCTCGTCTTCCGCTACGAGGAA
CCCAATCCCATGACACGCTGGGATAGCCCCCTCTTTGCTCTTGTATGGGACGACGACGCGGAGCAAACAACAAAG
ACATTCGACGCTCTTTGGGACGCAATTGCAGGCCAAGGACGCCGCATCATCCGTCCTAATCAGGCCACAGTTCAA
CGTGGACGCGATGCCGACGGTGATTACCTCTACCTTCTCGACCGCGAAACCCAACATGTTGTCAAGTGCATTCTC
GGCCACCAACAAAACGTCGATGGTGCTGGAGGATTAGTCAAAATAGCACTGAACGGTGCCGAGAAAGAACATGCC
ATTGTGGAGCTCCCCCCCGACAAAAGGCTCGGCCTACCGCAGCTGCAGCGGCTCAGAAGAGCATTCATTGGTCTG
AATAGAGGTGGCATTGGCCTTGAGTCTGTGGGTAATATGGCAATTGATGGCCTGAGGGAAGCCTTTGTTCGTTAT
CTCAACGACGCTTTCGAAGAGGGCGACTAG
Gene >OphauG2|670
ATGCCGGTACTCACACAAGCTATTCTTCTTGCGCCGTCATGGGCTGACCTGGACAATCCTGGCAGCTCATCATCG
TCACCGGCCTCCCCACCTCAGGCAAATCAACGCGTGCAAAACAGCTTCATCAATATCTGCTGAAACGCGTCCCCG
ATCCCAAGCGTCTGCACATTGTATCCGACGACTTGCTGTCCATATCCAGAAGTGTCTATGACCTCTCGCCTTCCA
AACTCGCCGCCCACACACGCTCTGCCAATGCCTCAGAAAAGGACGCCCGCGCTGCCCTATACGCCGCCGTCAAAC
GCCAGCTCTCGGACAAGGACTTCGTCATTCTAGACAGCCTCAACTATATCAAAGGTTGGCGCTACCAGCTGCATT
GCGAGGCCAAGGCGGTGTGCACTCCGAGCTGCCTCTTGCAAGTTGCATGTTCCCGCCATCAAGCTAGACAGGTCA
ATGAGCAACGGCTGCAAAGACGCCATGGCCATGATGACAAGGCAGAACACGATCAAGAGCACGGCGACGATTCTT
GCCATGTTGAGCCATATGAGCCTGACAATTGGGATAACCTCGTCTTCCGCTACGAGGAACCCAATCCCATGACAC
GCTGGGATAGCCCCCTCTTTGCTCTTGTATGGGACGACGACGCGGAGCAAACAACAAAGACATTCGACGCTCTTT
GGGACGCAATTGCAGGCCAAGGACGCCGCATCATCCGTCCTAATCAGGCCACAGTTCAACGTGGACGCGATGCCG
ACGGTGATTACCTCTACCTTCTCGACCGCGAAACCCAACATGTTGTCAAGTGCATTCTCGGCCACCAACAAAACG
TCGATGGTGCTGGAGGATTAGTCAAAATAGCACTGAACGGTGCCGAGAAAGAACATGCCATTGTGGAGCTCCCCC
CCGACAAAAGGCTCGGCCTACCGCAGCTGCAGCGGCTCAGAAGAGCATTCATTGGTCTGAATAGAGGTGGCATTG
GCCTTGAGTCTGTGGGTAATATGGCAATTGATGGCCTGAGGGAAGCCTTTGTTCGTTATCTCAACGACGCTTTCG
AAGAGGGCGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail