Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6688
Gene name
LocationContig_708:9000..9899
Strand+
Gene length (bp)899
Transcript length (bp)852
Coding sequence length (bp)852
Protein length (aa) 284

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5469
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6688 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7190
Ophiocordyceps camponoti-floridani Ophcf2|06284
Ophiocordyceps camponoti-rufipedis Ophun1|4968
Ophiocordyceps kimflemingae Ophio5|1716
Ophiocordyceps subramaniannii Hirsu2|6367

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6688
MTVEQRRSGMTLEQRISILTLDHNQQQAATPAFVRSEPYSYKRPSQPYIDVPTRLIDSEPGAPLELSPIVTADLS
SSDAALFKRVIQEDITRHGKIVAEQQKGKWQAGWRYNDSWVYALRYKAQCVLDHLWIGPLSVVRDVEFLRREGFS
MVLVARDERLANTRLPTLHEACRVLDLASRCFAIDCKGRGLVGQLAGIMDAIKTHVVAVERRRGTHESSRRAKIL
IVCNTGNELAPGIAAAYLMAVFGQTLTQAFETVMTARYSYGRGAHGGGGGGEWAAAAE*
Coding >OphauG2|6688
ATGACTGTCGAGCAAAGGAGAAGCGGCATGACTCTCGAGCAAAGGATAAGCATCTTGACTCTCGATCATAATCAG
CAGCAGGCCGCCACGCCAGCCTTTGTACGGTCCGAGCCATACAGCTACAAGAGGCCATCGCAGCCGTACATTGAT
GTGCCGACGAGACTCATAGACAGCGAGCCGGGGGCGCCTCTAGAGCTATCGCCCATTGTAACGGCAGACCTGAGC
AGCAGCGACGCCGCGCTGTTTAAGCGAGTGATTCAAGAGGACATTACCCGGCACGGCAAGATTGTGGCGGAGCAG
CAAAAGGGAAAATGGCAAGCTGGATGGCGGTACAACGACTCGTGGGTATACGCGCTGCGATACAAGGCGCAGTGC
GTGCTGGACCACTTGTGGATTGGGCCGCTGAGCGTGGTTCGCGACGTGGAGTTTTTGAGACGCGAGGGGTTTAGC
ATGGTGCTGGTTGCGCGGGATGAGCGTCTTGCAAATACGCGGCTGCCGACGCTGCACGAGGCGTGTAGGGTGCTG
GACCTGGCGAGCCGGTGCTTTGCGATTGATTGCAAGGGCCGCGGGCTGGTTGGCCAACTGGCGGGCATCATGGAC
GCCATCAAGACGCACGTGGTGGCGGTGGAGCGTCGACGCGGCACGCACGAGTCGTCGCGCCGGGCAAAGATATTG
ATTGTCTGCAACACGGGCAACGAGCTGGCGCCAGGCATTGCGGCGGCATACCTGATGGCGGTGTTTGGGCAGACG
CTGACGCAGGCTTTTGAAACAGTGATGACGGCGCGCTATTCATATGGTCGAGGCGCGCATGGCGGTGGCGGCGGA
GGCGAGTGGGCGGCAGCAGCGGAGTAA
Transcript >OphauG2|6688
ATGACTGTCGAGCAAAGGAGAAGCGGCATGACTCTCGAGCAAAGGATAAGCATCTTGACTCTCGATCATAATCAG
CAGCAGGCCGCCACGCCAGCCTTTGTACGGTCCGAGCCATACAGCTACAAGAGGCCATCGCAGCCGTACATTGAT
GTGCCGACGAGACTCATAGACAGCGAGCCGGGGGCGCCTCTAGAGCTATCGCCCATTGTAACGGCAGACCTGAGC
AGCAGCGACGCCGCGCTGTTTAAGCGAGTGATTCAAGAGGACATTACCCGGCACGGCAAGATTGTGGCGGAGCAG
CAAAAGGGAAAATGGCAAGCTGGATGGCGGTACAACGACTCGTGGGTATACGCGCTGCGATACAAGGCGCAGTGC
GTGCTGGACCACTTGTGGATTGGGCCGCTGAGCGTGGTTCGCGACGTGGAGTTTTTGAGACGCGAGGGGTTTAGC
ATGGTGCTGGTTGCGCGGGATGAGCGTCTTGCAAATACGCGGCTGCCGACGCTGCACGAGGCGTGTAGGGTGCTG
GACCTGGCGAGCCGGTGCTTTGCGATTGATTGCAAGGGCCGCGGGCTGGTTGGCCAACTGGCGGGCATCATGGAC
GCCATCAAGACGCACGTGGTGGCGGTGGAGCGTCGACGCGGCACGCACGAGTCGTCGCGCCGGGCAAAGATATTG
ATTGTCTGCAACACGGGCAACGAGCTGGCGCCAGGCATTGCGGCGGCATACCTGATGGCGGTGTTTGGGCAGACG
CTGACGCAGGCTTTTGAAACAGTGATGACGGCGCGCTATTCATATGGTCGAGGCGCGCATGGCGGTGGCGGCGGA
GGCGAGTGGGCGGCAGCAGCGGAGTAA
Gene >OphauG2|6688
ATGACTGTCGAGCAAAGGAGAAGCGGCATGACTCTCGAGCAAAGGATAAGCATCTTGACTCTCGATCATAATCAG
CAGCAGGCCGCCACGCCAGCCTTTGTACGGTCCGAGCCATACAGCTACAAGAGGCCATCGCAGCCGTACATTGAT
GTGCCGACGAGACTCATAGACAGCGAGCCGGGGGCGCCTCTAGAGCTATCGCCCATTGTAACGGCAGACCTGAGC
AGCAGCGACGCCGCGCTGTTTAAGCGAGTGATTCAAGAGGACATTACCCGGCACGGCAAGATTGTGGCGGAGCAG
CAAAAGGGAAAATGGCAAGCTGGATGGCGGTACAACGACTCGTGGGTATACGCGCTGCGATACAAGGCGCAGTGC
GTGCTGGACCACTTGTGGATTGGGCCGCTGAGCGTGGTTCGCGACGTGGAGTTTTTGAGACGCGAGGGGTTTAGC
ATGGTGCTGGTTGCGCGGGATGAGCGTCTTGCAAATACGCGGCTGCCGACGCTGCACGAGGCGTGTAGGGTGCTG
GACCTGGCGAGCCGGTGCTTTGCGATTGATTGCAAGGGCCGCGGGCTGGTTGGCCAACTGGCGGGCATCATGGAC
GCCATCAAGACGCACGTGGTGGCGGTGGAGCGTCGACGCGGCACGCACGAGTCGTCGCGCCGGGCAAAGATATTG
ATTGTCTGCAACACGGGCAACGAGCTGGCGCCAGGCATTGCGGCGGCATACCTGATGGCGGTGTTTGGGCAGACG
CTGACGCAGGCTTTTGAAACAGTGATGACGGCGCGCTATTCATGTGCCTTTGACGAAGGGACAAAGCAGAGTCTG
GTGACGTGGGCGCAGATGGTCGAGGCGCGCATGGCGGTGGCGGCGGAGGCGAGTGGGCGGCAGCAGCGGAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail