Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6680
Gene name
LocationContig_707:4159..4874
Strand+
Gene length (bp)715
Transcript length (bp)660
Coding sequence length (bp)660
Protein length (aa) 220

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06244 Ccdc124 Coiled-coil domain-containing protein 124 /Oxs1 2.2E-25 102 190

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94389|CC124_SCHPO Coiled-coil domain-containing protein 124 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A10.12 PE=3 SV=1 41 217 2.0E-26
sp|Q28HN4|CC124_XENTR Coiled-coil domain-containing protein 124 OS=Xenopus tropicalis GN=ccdc124 PE=2 SV=1 5 197 3.0E-16
sp|Q68EY7|C124A_XENLA Coiled-coil domain-containing protein 124-A OS=Xenopus laevis GN=ccdc124-a PE=2 SV=1 5 197 3.0E-14
sp|Q6PHE8|CC124_DANRE Coiled-coil domain-containing protein 124 OS=Danio rerio GN=ccdc124 PE=2 SV=1 5 197 5.0E-13
sp|Q6DD17|C124B_XENLA Coiled-coil domain-containing protein 124-B OS=Xenopus laevis GN=ccdc124-b PE=2 SV=1 71 197 7.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94389|CC124_SCHPO Coiled-coil domain-containing protein 124 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A10.12 PE=3 SV=1 41 217 2.0E-26
sp|Q28HN4|CC124_XENTR Coiled-coil domain-containing protein 124 OS=Xenopus tropicalis GN=ccdc124 PE=2 SV=1 5 197 3.0E-16
sp|Q68EY7|C124A_XENLA Coiled-coil domain-containing protein 124-A OS=Xenopus laevis GN=ccdc124-a PE=2 SV=1 5 197 3.0E-14
sp|Q6PHE8|CC124_DANRE Coiled-coil domain-containing protein 124 OS=Danio rerio GN=ccdc124 PE=2 SV=1 5 197 5.0E-13
sp|Q6DD17|C124B_XENLA Coiled-coil domain-containing protein 124-B OS=Xenopus laevis GN=ccdc124-b PE=2 SV=1 71 197 7.0E-11
sp|Q5R8X8|CC124_PONAB Coiled-coil domain-containing protein 124 OS=Pongo abelii GN=CCDC124 PE=2 SV=1 60 199 3.0E-09
sp|Q9D8X2|CC124_MOUSE Coiled-coil domain-containing protein 124 OS=Mus musculus GN=Ccdc124 PE=1 SV=1 5 199 3.0E-09
sp|Q96CT7|CC124_HUMAN Coiled-coil domain-containing protein 124 OS=Homo sapiens GN=CCDC124 PE=1 SV=1 5 199 8.0E-09
sp|Q54GW3|CC124_DICDI Coiled-coil domain-containing protein 124 homolog OS=Dictyostelium discoideum GN=DDB_G0289893 PE=3 SV=1 111 191 2.0E-08
sp|Q2TBV6|CC124_BOVIN Coiled-coil domain-containing protein 124 OS=Bos taurus GN=CCDC124 PE=2 SV=1 5 199 3.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5704
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6680 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2760
Ophiocordyceps camponoti-floridani Ophcf2|04183
Ophiocordyceps kimflemingae Ophio5|1195
Ophiocordyceps subramaniannii Hirsu2|8766

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6680
MAGKKGENSKKAAGNARKAEAAALKTAANEAKLEAAESEKWQKGSKSNAKREAEEAKRAEQAQKRAEKEALLKEE
EANMGGRSEPKKSKAPVKKSRALNLSQLDHDGPATALNASGIENALDALSLAGPPDNSKLEKHPERRFPAALRQY
EERRLQEMKADGTAIGLRLDQRKQRIRKEFEKSPENPFNQVTVAYNATKDDLAEVKAQEAAKIEKRLGQ*
Coding >OphauG2|6680
ATGGCGGGCAAAAAGGGCGAAAACAGCAAAAAGGCGGCGGGCAACGCGCGCAAGGCAGAGGCTGCTGCCCTCAAG
ACTGCAGCCAACGAGGCAAAGCTCGAGGCTGCCGAGTCGGAAAAATGGCAAAAAGGCTCAAAGAGCAACGCCAAA
AGAGAAGCCGAAGAAGCCAAGCGGGCTGAGCAGGCCCAGAAGCGCGCCGAAAAGGAAGCTCTACTCAAAGAGGAA
GAGGCCAACATGGGCGGTCGCTCAGAGCCCAAAAAGTCAAAGGCGCCCGTCAAGAAATCGCGCGCTCTCAATCTG
TCGCAACTTGACCATGACGGCCCAGCTACCGCTCTCAACGCTTCCGGCATCGAGAATGCCCTCGATGCCCTGTCT
CTCGCTGGGCCTCCAGATAACAGCAAGCTGGAAAAGCATCCTGAGCGGCGCTTCCCCGCTGCTTTGCGCCAATAC
GAGGAGCGGCGGCTACAGGAGATGAAGGCCGACGGCACCGCCATTGGCCTGCGCCTCGACCAGCGCAAGCAGCGC
ATCCGCAAGGAGTTCGAAAAGAGCCCCGAGAATCCCTTTAACCAGGTAACCGTGGCTTACAACGCCACCAAGGAT
GATTTAGCCGAGGTCAAGGCACAAGAGGCGGCAAAGATTGAGAAGCGTCTGGGTCAGTAG
Transcript >OphauG2|6680
ATGGCGGGCAAAAAGGGCGAAAACAGCAAAAAGGCGGCGGGCAACGCGCGCAAGGCAGAGGCTGCTGCCCTCAAG
ACTGCAGCCAACGAGGCAAAGCTCGAGGCTGCCGAGTCGGAAAAATGGCAAAAAGGCTCAAAGAGCAACGCCAAA
AGAGAAGCCGAAGAAGCCAAGCGGGCTGAGCAGGCCCAGAAGCGCGCCGAAAAGGAAGCTCTACTCAAAGAGGAA
GAGGCCAACATGGGCGGTCGCTCAGAGCCCAAAAAGTCAAAGGCGCCCGTCAAGAAATCGCGCGCTCTCAATCTG
TCGCAACTTGACCATGACGGCCCAGCTACCGCTCTCAACGCTTCCGGCATCGAGAATGCCCTCGATGCCCTGTCT
CTCGCTGGGCCTCCAGATAACAGCAAGCTGGAAAAGCATCCTGAGCGGCGCTTCCCCGCTGCTTTGCGCCAATAC
GAGGAGCGGCGGCTACAGGAGATGAAGGCCGACGGCACCGCCATTGGCCTGCGCCTCGACCAGCGCAAGCAGCGC
ATCCGCAAGGAGTTCGAAAAGAGCCCCGAGAATCCCTTTAACCAGGTAACCGTGGCTTACAACGCCACCAAGGAT
GATTTAGCCGAGGTCAAGGCACAAGAGGCGGCAAAGATTGAGAAGCGTCTGGGTCAGTAG
Gene >OphauG2|6680
ATGGCGGGCAAAAAGGGCGAAAACAGCAAAAAGGCGGCGGGCAACGCGCGCAAGGCAGAGGCTGCTGCCCTCAAG
ACTGCAGCCAACGAGGCAAAGCTCGAGGCTGCCGAGTCGGAAAAATGGCAAAAAGGCTCAAAGAGCAACGCCAAA
AGGTAGCAGCCTCCTCCCCGCCTGGGCGGCTCTGACACTGGGCTGACGCTTGTTCAGAGAAGCCGAAGAAGCCAA
GCGGGCTGAGCAGGCCCAGAAGCGCGCCGAAAAGGAAGCTCTACTCAAAGAGGAAGAGGCCAACATGGGCGGTCG
CTCAGAGCCCAAAAAGTCAAAGGCGCCCGTCAAGAAATCGCGCGCTCTCAATCTGTCGCAACTTGACCATGACGG
CCCAGCTACCGCTCTCAACGCTTCCGGCATCGAGAATGCCCTCGATGCCCTGTCTCTCGCTGGGCCTCCAGATAA
CAGCAAGCTGGAAAAGCATCCTGAGCGGCGCTTCCCCGCTGCTTTGCGCCAATACGAGGAGCGGCGGCTACAGGA
GATGAAGGCCGACGGCACCGCCATTGGCCTGCGCCTCGACCAGCGCAAGCAGCGCATCCGCAAGGAGTTCGAAAA
GAGCCCCGAGAATCCCTTTAACCAGGTAACCGTGGCTTACAACGCCACCAAGGATGATTTAGCCGAGGTCAAGGC
ACAAGAGGCGGCAAAGATTGAGAAGCGTCTGGGTCAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail