Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6674
Gene name
LocationContig_704:4487..5308
Strand+
Gene length (bp)821
Transcript length (bp)675
Coding sequence length (bp)675
Protein length (aa) 225

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.99978

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup854
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6674 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4345
Ophiocordyceps camponoti-floridani Ophcf2|00309
Ophiocordyceps camponoti-rufipedis Ophun1|1838
Ophiocordyceps camponoti-rufipedis Ophun1|2514
Ophiocordyceps kimflemingae Ophio5|1373
Ophiocordyceps subramaniannii Hirsu2|4665

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6674
MKYSLVTLSALAAFAVAEPPKFLNTKFDVQEGKEFPIKFSGCEKTCTISIRDGPSNNLGPGKALTTTATGGVFNF
SPKDLPSNTYAFEIKDNASGEVNYSVQFPYQGTGPAISSSAVSSAVMTSATSVPASSAAMTSAATSAKPISTSLA
ATSVMPVTTSIVHHRNTTMATSSARTSAAHTSGVATSGVSRPSGPATQVPSSDVGRLSAPLALAVGIVAAAFFG*
Coding >OphauG2|6674
ATGAAGTACTCTCTCGTCACTCTGTCGGCCCTTGCCGCCTTTGCCGTTGCCGAGCCGCCCAAGTTCCTCAACACC
AAGTTCGATGTCCAGGAGGGCAAGGAATTCCCCATCAAGTTCAGCGGCTGCGAGAAAACCTGCACCATTTCTATC
CGCGATGGCCCCAGCAACAACCTTGGACCTGGCAAGGCTCTGACGACCACTGCCACTGGAGGCGTCTTTAACTTT
TCGCCAAAGGATCTCCCCTCCAACACGTATGCCTTTGAGATCAAGGACAATGCCTCTGGCGAGGTCAACTACAGC
GTTCAGTTCCCTTACCAGGGCACCGGCCCAGCCATTTCGTCATCGGCTGTGTCGTCTGCCGTCATGACATCGGCC
ACGTCAGTCCCTGCCTCGTCTGCTGCCATGACTTCGGCGGCTACGTCTGCCAAGCCTATTAGCACGTCGCTTGCC
GCCACATCTGTGATGCCTGTTACCACGTCAATTGTTCACCACCGCAATACGACAATGGCTACCAGCAGCGCCCGC
ACTTCTGCGGCTCACACGTCTGGCGTGGCCACGTCTGGTGTCTCTCGCCCCAGCGGCCCTGCCACGCAGGTGCCC
AGCAGCGACGTTGGTCGTTTGTCGGCGCCGCTGGCGCTTGCCGTTGGCATTGTCGCAGCCGCCTTTTTCGGTTAA
Transcript >OphauG2|6674
ATGAAGTACTCTCTCGTCACTCTGTCGGCCCTTGCCGCCTTTGCCGTTGCCGAGCCGCCCAAGTTCCTCAACACC
AAGTTCGATGTCCAGGAGGGCAAGGAATTCCCCATCAAGTTCAGCGGCTGCGAGAAAACCTGCACCATTTCTATC
CGCGATGGCCCCAGCAACAACCTTGGACCTGGCAAGGCTCTGACGACCACTGCCACTGGAGGCGTCTTTAACTTT
TCGCCAAAGGATCTCCCCTCCAACACGTATGCCTTTGAGATCAAGGACAATGCCTCTGGCGAGGTCAACTACAGC
GTTCAGTTCCCTTACCAGGGCACCGGCCCAGCCATTTCGTCATCGGCTGTGTCGTCTGCCGTCATGACATCGGCC
ACGTCAGTCCCTGCCTCGTCTGCTGCCATGACTTCGGCGGCTACGTCTGCCAAGCCTATTAGCACGTCGCTTGCC
GCCACATCTGTGATGCCTGTTACCACGTCAATTGTTCACCACCGCAATACGACAATGGCTACCAGCAGCGCCCGC
ACTTCTGCGGCTCACACGTCTGGCGTGGCCACGTCTGGTGTCTCTCGCCCCAGCGGCCCTGCCACGCAGGTGCCC
AGCAGCGACGTTGGTCGTTTGTCGGCGCCGCTGGCGCTTGCCGTTGGCATTGTCGCAGCCGCCTTTTTCGGTTAA
Gene >OphauG2|6674
ATGAAGTACTCTCTCGTCACTCTGTCGGCCCTTGCCGCCTTTGCCGTTGCCGAGCCGCCCAAGTTCCTCAACACC
AAGTTCGATGTCCAGGAGGGCAAGGAATTCCCCATCAAGTTCAGCGGCTGCGAGAAAACCTGCACCATTTCTATC
CGCGATGGCCCCAGCAACAACCTTGGACCTGGCAAGGCTCTGACGAGTACGTCTTACCAATCCCAAACCCCCCAA
CCAACAAGGCCTTTTTTGTACCCCGTGACGCACAAGGAGACTGACATTGCCCCAACAGCCACTGCCACTGGAGGC
GTCTTTAACTTTTCGCCAAAGGATCTCCCCTCCAACACGTATGCCTTTGAGATCAAGGACAATGCCTCTGGCGAG
GTCAACTACAGCGTTCAGTTCCCTTACCAGGGCACCGGCCCAGCCATTTCGTCATCGGCTGTGTCGTCTGCCGTC
ATGACATCGGCCACGTCAGTCCCTGCCTCGTCTGCTGCCATGACTTCGGCGGCTACGTCTGCCAAGCCTATTAGC
ACGTCGCTTGCCGCCACATCTGTGATGCCTGTTACCACGTCAATTGTTCACCACCGCAATACGACAATGGCTACC
AGCAGCGCCCGTGAGTTTATCTCTCTCTTTTTAATTTTTGTTACACGAGCTGATTGAGATGGTTTATAGGCACTT
CTGCGGCTCACACGTCTGGCGTGGCCACGTCTGGTGTCTCTCGCCCCAGCGGCCCTGCCACGCAGGTGCCCAGCA
GCGACGTTGGTCGTTTGTCGGCGCCGCTGGCGCTTGCCGTTGGCATTGTCGCAGCCGCCTTTTTCGGTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail