Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6671
Gene name
LocationContig_703:2359..2851
Strand-
Gene length (bp)492
Transcript length (bp)492
Coding sequence length (bp)492
Protein length (aa) 164

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9C2N1|VIB1_NEUCR Transcription factor vib-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vib-1 PE=3 SV=1 1 162 9.0E-07

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup974
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6671 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|6672
Ophiocordyceps australis map64 (Brazil) OphauB2|2872
Ophiocordyceps camponoti-floridani Ophcf2|04880
Ophiocordyceps camponoti-rufipedis Ophun1|5193
Ophiocordyceps kimflemingae Ophio5|6216
Ophiocordyceps subramaniannii Hirsu2|783

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6671
MPLPLASNDGPLRSHYSYTSTGHGAHADNSSMSMPRYVDSNPRPSKSPRQSGHQSVHSGGSVGDSTGTASSSDYR
YGSTGASSYRGSENAYPPSSSWATTSSEHSSSSAYAAADARSYSFSSHEPYRAGGTIPPLKHEPNSSVYSGGPRG
SFDSINNYSWSAA*
Coding >OphauG2|6671
ATGCCGCTGCCCCTGGCCAGCAACGACGGGCCCCTGCGGTCACACTACTCGTACACGTCAACCGGCCATGGAGCA
CACGCCGACAACAGCAGCATGAGCATGCCGCGCTACGTCGACAGCAACCCGCGGCCAAGCAAGAGCCCGCGCCAG
TCGGGCCACCAGTCGGTGCACAGTGGCGGCTCCGTCGGCGACTCAACAGGCACCGCCTCGTCTTCCGACTACCGC
TACGGCAGCACTGGTGCGTCGTCGTACCGCGGAAGCGAAAACGCCTACCCGCCCTCCAGCTCCTGGGCCACCACG
TCGTCTGAGCACAGCTCCAGCTCTGCATATGCCGCTGCCGATGCCCGCTCCTATTCCTTCTCCTCCCATGAGCCC
TACCGCGCTGGCGGCACCATCCCCCCCTTGAAGCATGAGCCCAACTCGAGCGTCTACAGCGGAGGGCCGAGGGGG
TCCTTTGATTCCATCAACAACTATTCCTGGAGCGCAGCCTAA
Transcript >OphauG2|6671
ATGCCGCTGCCCCTGGCCAGCAACGACGGGCCCCTGCGGTCACACTACTCGTACACGTCAACCGGCCATGGAGCA
CACGCCGACAACAGCAGCATGAGCATGCCGCGCTACGTCGACAGCAACCCGCGGCCAAGCAAGAGCCCGCGCCAG
TCGGGCCACCAGTCGGTGCACAGTGGCGGCTCCGTCGGCGACTCAACAGGCACCGCCTCGTCTTCCGACTACCGC
TACGGCAGCACTGGTGCGTCGTCGTACCGCGGAAGCGAAAACGCCTACCCGCCCTCCAGCTCCTGGGCCACCACG
TCGTCTGAGCACAGCTCCAGCTCTGCATATGCCGCTGCCGATGCCCGCTCCTATTCCTTCTCCTCCCATGAGCCC
TACCGCGCTGGCGGCACCATCCCCCCCTTGAAGCATGAGCCCAACTCGAGCGTCTACAGCGGAGGGCCGAGGGGG
TCCTTTGATTCCATCAACAACTATTCCTGGAGCGCAGCCTAA
Gene >OphauG2|6671
ATGCCGCTGCCCCTGGCCAGCAACGACGGGCCCCTGCGGTCACACTACTCGTACACGTCAACCGGCCATGGAGCA
CACGCCGACAACAGCAGCATGAGCATGCCGCGCTACGTCGACAGCAACCCGCGGCCAAGCAAGAGCCCGCGCCAG
TCGGGCCACCAGTCGGTGCACAGTGGCGGCTCCGTCGGCGACTCAACAGGCACCGCCTCGTCTTCCGACTACCGC
TACGGCAGCACTGGTGCGTCGTCGTACCGCGGAAGCGAAAACGCCTACCCGCCCTCCAGCTCCTGGGCCACCACG
TCGTCTGAGCACAGCTCCAGCTCTGCATATGCCGCTGCCGATGCCCGCTCCTATTCCTTCTCCTCCCATGAGCCC
TACCGCGCTGGCGGCACCATCCCCCCCTTGAAGCATGAGCCCAACTCGAGCGTCTACAGCGGAGGGCCGAGGGGG
TCCTTTGATTCCATCAACAACTATTCCTGGAGCGCAGCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail