Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6660
Gene name
LocationContig_70:32020..33922
Strand-
Gene length (bp)1902
Transcript length (bp)1902
Coding sequence length (bp)1902
Protein length (aa) 634

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01841 Transglut_core Transglutaminase-like superfamily 5.1E-11 315 432

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8NBH2|KY_HUMAN Kyphoscoliosis peptidase OS=Homo sapiens GN=KY PE=1 SV=2 300 475 7.0E-19
sp|Q8C8H8|KY_MOUSE Kyphoscoliosis peptidase OS=Mus musculus GN=Ky PE=1 SV=1 312 475 1.0E-18

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3470
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6660 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5944
Ophiocordyceps camponoti-floridani Ophcf2|03967
Ophiocordyceps camponoti-rufipedis Ophun1|6496
Ophiocordyceps kimflemingae Ophio5|2921
Ophiocordyceps subramaniannii Hirsu2|663

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6660
MADTDQPQFSSLAERIAALNKQKSFNTTAFNSDDRKRPPPPPPPSQPKDKSNTPSSSRPLPPPLPHRNLQTATPK
DDGGTNTISRAVAPLLPSRNSTAPSAHASPPLPRRTSTQSNVTAGRRNSASSLVSQNSTASSQRKLPPPNCDPAT
LPPLPPTRREREAKAKKSTTVNVVEVGSKRVAAPPTPSLPPRVPSRPVKSATPTEIKSADDKPTDGPRRKLPLAA
IKGFGSGDPTARRSNNGSTPTPSLEGAEAPPVPLASRPSDAQIDAASARTVSKSQQPSDCWICHDWSGVDEIAAQ
FPRNSLPRSDVVGHLAQGLCGHFSSAADKARAIFTWCHYNIYYDTASFFNNNIRAMPVEETIFSGRAVCQGYAET
YKAIAMRAGLECIVVSGHGKGFGHVPLQKGASAPPQGPDTHAWNAVWIDGHWKLVDACWGAGHIDGASKTFKRQF
APNHFTWSNDKFGLRHFPRDPRYQFRSDGRTLSWEEYYRGPFEGNSPAFYTNAHDEGIAEDSVEPRDRDIEVHSG
GMVRFQFCKICEHWTSEKNGLGKPPLLLLCINGAGGGTERQIPMETNGYWHWVDVEARELGVRGQSVQVSQLTML
DGRGARGVTGQQYLSRKNTGSTSWLSFIKWELV*
Coding >OphauG2|6660
ATGGCAGACACTGACCAGCCCCAATTCAGCTCGTTGGCTGAAAGAATCGCAGCCTTGAACAAGCAGAAAAGTTTC
AACACGACTGCTTTCAACTCTGACGACAGGAAAAGACCACCACCGCCGCCGCCACCGTCACAGCCCAAAGACAAA
TCAAACACGCCCTCTTCTTCACGACCACTACCACCGCCCTTGCCTCACCGCAATTTGCAAACGGCAACTCCCAAG
GACGACGGCGGAACAAACACCATCTCTCGCGCTGTGGCGCCTCTGCTGCCCTCTCGCAATTCAACAGCGCCGTCT
GCCCATGCTTCTCCTCCTTTGCCTCGACGCACGTCAACCCAATCCAATGTGACTGCTGGTCGGCGAAATTCAGCG
TCATCGCTCGTATCTCAAAACTCAACTGCCTCGTCCCAGCGTAAACTGCCCCCGCCCAACTGCGACCCGGCTACC
CTGCCGCCTTTACCACCCACCAGGCGCGAGCGAGAAGCCAAGGCCAAAAAATCAACCACAGTCAATGTGGTTGAA
GTTGGATCCAAGAGAGTAGCGGCGCCCCCGACACCCAGCCTCCCGCCCCGAGTGCCGTCAAGACCTGTCAAGTCG
GCCACTCCCACGGAGATCAAGTCGGCCGATGACAAGCCCACAGACGGCCCGCGTCGCAAGCTACCTCTAGCGGCC
ATCAAGGGGTTTGGCAGCGGTGATCCGACGGCGCGCCGCAGTAATAATGGCTCAACGCCCACGCCAAGTCTCGAG
GGCGCTGAAGCTCCTCCGGTGCCCCTGGCCTCAAGGCCCTCAGACGCTCAGATCGACGCTGCCTCGGCTCGCACC
GTTTCCAAGTCGCAGCAACCGAGTGATTGCTGGATATGTCACGACTGGAGCGGTGTGGACGAAATTGCGGCTCAG
TTTCCCCGCAACAGCCTGCCGAGGAGCGATGTTGTGGGACATCTCGCTCAGGGTCTCTGTGGCCACTTCAGCTCT
GCTGCCGACAAGGCGAGGGCCATCTTCACGTGGTGTCATTACAACATATATTACGACACGGCCTCTTTCTTTAAT
AATAATATCAGGGCCATGCCTGTCGAGGAGACAATTTTCAGCGGCAGGGCTGTCTGCCAGGGCTACGCGGAAACT
TACAAGGCCATTGCCATGAGAGCCGGCCTGGAATGTATCGTCGTGAGCGGCCACGGCAAGGGGTTTGGCCACGTG
CCGCTCCAAAAAGGGGCCTCTGCGCCACCACAAGGGCCAGACACGCATGCCTGGAACGCGGTGTGGATTGACGGG
CATTGGAAGCTGGTTGATGCCTGTTGGGGTGCTGGACATATCGATGGCGCATCCAAGACTTTCAAACGGCAATTC
GCCCCCAATCATTTTACGTGGAGCAACGACAAGTTTGGGCTGAGGCACTTTCCGCGCGATCCCCGGTACCAGTTT
CGCAGCGACGGACGCACCCTGTCATGGGAAGAGTATTACCGAGGCCCTTTTGAGGGCAACTCGCCAGCCTTTTAC
ACCAACGCGCACGATGAAGGCATTGCTGAGGACAGCGTGGAGCCAAGGGACCGCGACATTGAGGTGCACAGCGGC
GGCATGGTGCGCTTCCAGTTTTGCAAAATCTGCGAGCACTGGACGTCGGAAAAGAATGGGCTGGGCAAGCCGCCC
CTATTGCTTCTTTGCATCAACGGCGCGGGTGGTGGGACGGAAAGGCAGATTCCCATGGAGACGAATGGATACTGG
CACTGGGTCGACGTGGAGGCCAGGGAGCTGGGGGTGCGGGGGCAGTCTGTTCAGGTGTCGCAGCTGACCATGCTG
GATGGCCGGGGCGCACGAGGCGTGACGGGCCAGCAGTATCTTTCGAGGAAGAATACTGGCTCGACGTCGTGGCTC
TCGTTTATCAAGTGGGAGCTGGTTTAA
Transcript >OphauG2|6660
ATGGCAGACACTGACCAGCCCCAATTCAGCTCGTTGGCTGAAAGAATCGCAGCCTTGAACAAGCAGAAAAGTTTC
AACACGACTGCTTTCAACTCTGACGACAGGAAAAGACCACCACCGCCGCCGCCACCGTCACAGCCCAAAGACAAA
TCAAACACGCCCTCTTCTTCACGACCACTACCACCGCCCTTGCCTCACCGCAATTTGCAAACGGCAACTCCCAAG
GACGACGGCGGAACAAACACCATCTCTCGCGCTGTGGCGCCTCTGCTGCCCTCTCGCAATTCAACAGCGCCGTCT
GCCCATGCTTCTCCTCCTTTGCCTCGACGCACGTCAACCCAATCCAATGTGACTGCTGGTCGGCGAAATTCAGCG
TCATCGCTCGTATCTCAAAACTCAACTGCCTCGTCCCAGCGTAAACTGCCCCCGCCCAACTGCGACCCGGCTACC
CTGCCGCCTTTACCACCCACCAGGCGCGAGCGAGAAGCCAAGGCCAAAAAATCAACCACAGTCAATGTGGTTGAA
GTTGGATCCAAGAGAGTAGCGGCGCCCCCGACACCCAGCCTCCCGCCCCGAGTGCCGTCAAGACCTGTCAAGTCG
GCCACTCCCACGGAGATCAAGTCGGCCGATGACAAGCCCACAGACGGCCCGCGTCGCAAGCTACCTCTAGCGGCC
ATCAAGGGGTTTGGCAGCGGTGATCCGACGGCGCGCCGCAGTAATAATGGCTCAACGCCCACGCCAAGTCTCGAG
GGCGCTGAAGCTCCTCCGGTGCCCCTGGCCTCAAGGCCCTCAGACGCTCAGATCGACGCTGCCTCGGCTCGCACC
GTTTCCAAGTCGCAGCAACCGAGTGATTGCTGGATATGTCACGACTGGAGCGGTGTGGACGAAATTGCGGCTCAG
TTTCCCCGCAACAGCCTGCCGAGGAGCGATGTTGTGGGACATCTCGCTCAGGGTCTCTGTGGCCACTTCAGCTCT
GCTGCCGACAAGGCGAGGGCCATCTTCACGTGGTGTCATTACAACATATATTACGACACGGCCTCTTTCTTTAAT
AATAATATCAGGGCCATGCCTGTCGAGGAGACAATTTTCAGCGGCAGGGCTGTCTGCCAGGGCTACGCGGAAACT
TACAAGGCCATTGCCATGAGAGCCGGCCTGGAATGTATCGTCGTGAGCGGCCACGGCAAGGGGTTTGGCCACGTG
CCGCTCCAAAAAGGGGCCTCTGCGCCACCACAAGGGCCAGACACGCATGCCTGGAACGCGGTGTGGATTGACGGG
CATTGGAAGCTGGTTGATGCCTGTTGGGGTGCTGGACATATCGATGGCGCATCCAAGACTTTCAAACGGCAATTC
GCCCCCAATCATTTTACGTGGAGCAACGACAAGTTTGGGCTGAGGCACTTTCCGCGCGATCCCCGGTACCAGTTT
CGCAGCGACGGACGCACCCTGTCATGGGAAGAGTATTACCGAGGCCCTTTTGAGGGCAACTCGCCAGCCTTTTAC
ACCAACGCGCACGATGAAGGCATTGCTGAGGACAGCGTGGAGCCAAGGGACCGCGACATTGAGGTGCACAGCGGC
GGCATGGTGCGCTTCCAGTTTTGCAAAATCTGCGAGCACTGGACGTCGGAAAAGAATGGGCTGGGCAAGCCGCCC
CTATTGCTTCTTTGCATCAACGGCGCGGGTGGTGGGACGGAAAGGCAGATTCCCATGGAGACGAATGGATACTGG
CACTGGGTCGACGTGGAGGCCAGGGAGCTGGGGGTGCGGGGGCAGTCTGTTCAGGTGTCGCAGCTGACCATGCTG
GATGGCCGGGGCGCACGAGGCGTGACGGGCCAGCAGTATCTTTCGAGGAAGAATACTGGCTCGACGTCGTGGCTC
TCGTTTATCAAGTGGGAGCTGGTTTAA
Gene >OphauG2|6660
ATGGCAGACACTGACCAGCCCCAATTCAGCTCGTTGGCTGAAAGAATCGCAGCCTTGAACAAGCAGAAAAGTTTC
AACACGACTGCTTTCAACTCTGACGACAGGAAAAGACCACCACCGCCGCCGCCACCGTCACAGCCCAAAGACAAA
TCAAACACGCCCTCTTCTTCACGACCACTACCACCGCCCTTGCCTCACCGCAATTTGCAAACGGCAACTCCCAAG
GACGACGGCGGAACAAACACCATCTCTCGCGCTGTGGCGCCTCTGCTGCCCTCTCGCAATTCAACAGCGCCGTCT
GCCCATGCTTCTCCTCCTTTGCCTCGACGCACGTCAACCCAATCCAATGTGACTGCTGGTCGGCGAAATTCAGCG
TCATCGCTCGTATCTCAAAACTCAACTGCCTCGTCCCAGCGTAAACTGCCCCCGCCCAACTGCGACCCGGCTACC
CTGCCGCCTTTACCACCCACCAGGCGCGAGCGAGAAGCCAAGGCCAAAAAATCAACCACAGTCAATGTGGTTGAA
GTTGGATCCAAGAGAGTAGCGGCGCCCCCGACACCCAGCCTCCCGCCCCGAGTGCCGTCAAGACCTGTCAAGTCG
GCCACTCCCACGGAGATCAAGTCGGCCGATGACAAGCCCACAGACGGCCCGCGTCGCAAGCTACCTCTAGCGGCC
ATCAAGGGGTTTGGCAGCGGTGATCCGACGGCGCGCCGCAGTAATAATGGCTCAACGCCCACGCCAAGTCTCGAG
GGCGCTGAAGCTCCTCCGGTGCCCCTGGCCTCAAGGCCCTCAGACGCTCAGATCGACGCTGCCTCGGCTCGCACC
GTTTCCAAGTCGCAGCAACCGAGTGATTGCTGGATATGTCACGACTGGAGCGGTGTGGACGAAATTGCGGCTCAG
TTTCCCCGCAACAGCCTGCCGAGGAGCGATGTTGTGGGACATCTCGCTCAGGGTCTCTGTGGCCACTTCAGCTCT
GCTGCCGACAAGGCGAGGGCCATCTTCACGTGGTGTCATTACAACATATATTACGACACGGCCTCTTTCTTTAAT
AATAATATCAGGGCCATGCCTGTCGAGGAGACAATTTTCAGCGGCAGGGCTGTCTGCCAGGGCTACGCGGAAACT
TACAAGGCCATTGCCATGAGAGCCGGCCTGGAATGTATCGTCGTGAGCGGCCACGGCAAGGGGTTTGGCCACGTG
CCGCTCCAAAAAGGGGCCTCTGCGCCACCACAAGGGCCAGACACGCATGCCTGGAACGCGGTGTGGATTGACGGG
CATTGGAAGCTGGTTGATGCCTGTTGGGGTGCTGGACATATCGATGGCGCATCCAAGACTTTCAAACGGCAATTC
GCCCCCAATCATTTTACGTGGAGCAACGACAAGTTTGGGCTGAGGCACTTTCCGCGCGATCCCCGGTACCAGTTT
CGCAGCGACGGACGCACCCTGTCATGGGAAGAGTATTACCGAGGCCCTTTTGAGGGCAACTCGCCAGCCTTTTAC
ACCAACGCGCACGATGAAGGCATTGCTGAGGACAGCGTGGAGCCAAGGGACCGCGACATTGAGGTGCACAGCGGC
GGCATGGTGCGCTTCCAGTTTTGCAAAATCTGCGAGCACTGGACGTCGGAAAAGAATGGGCTGGGCAAGCCGCCC
CTATTGCTTCTTTGCATCAACGGCGCGGGTGGTGGGACGGAAAGGCAGATTCCCATGGAGACGAATGGATACTGG
CACTGGGTCGACGTGGAGGCCAGGGAGCTGGGGGTGCGGGGGCAGTCTGTTCAGGTGTCGCAGCTGACCATGCTG
GATGGCCGGGGCGCACGAGGCGTGACGGGCCAGCAGTATCTTTCGAGGAAGAATACTGGCTCGACGTCGTGGCTC
TCGTTTATCAAGTGGGAGCTGGTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail