Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|666
Gene name
LocationContig_1169:4536..5319
Strand+
Gene length (bp)783
Transcript length (bp)516
Coding sequence length (bp)516
Protein length (aa) 172

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00838 TCTP Translationally controlled tumour protein 2.1E-71 1 166

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RYV5|TCTP_NEUCR Translationally-controlled tumor protein homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06464 PE=3 SV=1 1 171 2.0E-81
sp|Q4IJT5|TCTP_GIBZE Translationally-controlled tumor protein homolog OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FGSG_02523 PE=3 SV=1 1 171 2.0E-78
sp|Q6FKB6|TCTP_CANGA Translationally-controlled tumor protein homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0L12870g PE=3 SV=1 1 171 3.0E-71
sp|P35691|TCTP_YEAST Translationally-controlled tumor protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMA19 PE=1 SV=1 1 171 2.0E-69
sp|Q5A860|TCTP_CANAL Translationally-controlled tumor protein homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TMA19 PE=3 SV=1 1 171 1.0E-67
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RYV5|TCTP_NEUCR Translationally-controlled tumor protein homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06464 PE=3 SV=1 1 171 2.0E-81
sp|Q4IJT5|TCTP_GIBZE Translationally-controlled tumor protein homolog OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FGSG_02523 PE=3 SV=1 1 171 2.0E-78
sp|Q6FKB6|TCTP_CANGA Translationally-controlled tumor protein homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0L12870g PE=3 SV=1 1 171 3.0E-71
sp|P35691|TCTP_YEAST Translationally-controlled tumor protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMA19 PE=1 SV=1 1 171 2.0E-69
sp|Q5A860|TCTP_CANAL Translationally-controlled tumor protein homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TMA19 PE=3 SV=1 1 171 1.0E-67
sp|Q6CTH3|TCTP_KLULA Translationally-controlled tumor protein homolog OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0C12716g PE=3 SV=1 1 171 5.0E-67
sp|Q6BP09|TCTP_DEBHA Translationally-controlled tumor protein homolog OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2E17468g PE=3 SV=1 1 171 4.0E-66
sp|Q6C4G1|TCTP_YARLI Translationally-controlled tumor protein homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E27071g PE=3 SV=1 1 171 9.0E-66
sp|P0CR82|TCTP_CRYNJ Translationally-controlled tumor protein homolog OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNM01460 PE=3 SV=1 1 171 1.0E-63
sp|P0CR83|TCTP_CRYNB Translationally-controlled tumor protein homolog OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBM1320 PE=3 SV=1 1 171 1.0E-63
sp|Q10344|TCTP_SCHPO Translationally-controlled tumor protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=p23fy PE=1 SV=1 1 170 3.0E-56
sp|Q4PF30|TCTP_USTMA Translationally-controlled tumor protein homolog OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_12131 PE=3 SV=2 1 171 3.0E-54
sp|Q2UR29|TCTP_ASPOR Translationally-controlled tumor protein homolog OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090005000996 PE=3 SV=1 1 171 4.0E-46
sp|Q9DGK4|TCTP_DANRE Translationally-controlled tumor protein homolog OS=Danio rerio GN=tpt1 PE=2 SV=1 1 166 2.0E-45
sp|Q98SJ7|TCTP_LABRO Translationally-controlled tumor protein homolog OS=Labeo rohita GN=tpt1 PE=2 SV=1 1 166 1.0E-44
sp|P91800|TCTP_SCHJA Translationally-controlled tumor protein homolog OS=Schistosoma japonicum GN=TCTP PE=2 SV=1 1 170 5.0E-43
sp|Q5E984|TCTP_BOVIN Translationally-controlled tumor protein OS=Bos taurus GN=TPT1 PE=2 SV=1 1 166 6.0E-43
sp|P61288|TCTP_PIG Translationally-controlled tumor protein OS=Sus scrofa GN=TPT1 PE=2 SV=1 1 166 9.0E-43
sp|A5A6K2|TCTP_PANTR Translationally-controlled tumor protein OS=Pan troglodytes GN=TPT1 PE=2 SV=1 1 166 9.0E-43
sp|P13693|TCTP_HUMAN Translationally-controlled tumor protein OS=Homo sapiens GN=TPT1 PE=1 SV=1 1 166 9.0E-43
sp|P43348|TCTP_RABIT Translationally-controlled tumor protein OS=Oryctolagus cuniculus GN=TPT1 PE=2 SV=2 1 166 9.0E-42
sp|P43347|TCTP_CHICK Translationally-controlled tumor protein homolog OS=Gallus gallus GN=TPT1 PE=2 SV=1 1 166 3.0E-41
sp|Q9M5G3|TCTP_HORVU Translationally-controlled tumor protein homolog OS=Hordeum vulgare GN=TCTP PE=2 SV=2 1 171 5.0E-41
sp|P63028|TCTP_MOUSE Translationally-controlled tumor protein OS=Mus musculus GN=Tpt1 PE=1 SV=1 1 166 3.0E-40
sp|P63029|TCTP_RAT Translationally-controlled tumor protein OS=Rattus norvegicus GN=Tpt1 PE=1 SV=1 1 166 3.0E-40
sp|T1DKS4|TCTP_CROHD Translationally-controlled tumor protein homolog OS=Crotalus horridus PE=2 SV=1 1 166 5.0E-39
sp|J3SFJ3|TCTP_CROAD Translationally-controlled tumor protein homolog OS=Crotalus adamanteus PE=2 SV=1 1 166 5.0E-39
sp|Q4WRB8|TCTP_ASPFU Translationally-controlled tumor protein homolog OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_1G16840 PE=3 SV=1 1 171 8.0E-39
sp|P31265|TCTP1_ARATH Translationally-controlled tumor protein 1 OS=Arabidopsis thaliana GN=TCTP1 PE=1 SV=2 1 171 2.0E-38
sp|Q2PS27|TCTP_CUCMA Translationally-controlled tumor protein homolog OS=Cucurbita maxima GN=TCTP PE=2 SV=1 1 171 9.0E-38
sp|Q6XSH4|TCTP_LATJA Translationally-controlled tumor protein homolog OS=Lateolabrax japonicus GN=tpt1 PE=2 SV=1 1 166 1.0E-37
sp|Q66JC5|TCTP_XENTR Translationally-controlled tumor protein homolog OS=Xenopus tropicalis GN=tpt1 PE=2 SV=1 1 171 1.0E-37
sp|Q5BFN9|TCTP_EMENI Translationally-controlled tumor protein homolog OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN0641 PE=1 SV=1 1 171 3.0E-37
sp|U3EQ60|TCTP_MICFL Translationally-controlled tumor protein homolog OS=Micrurus fulvius PE=2 SV=1 1 166 1.0E-36
sp|O03992|TCTP_FRAAN Translationally-controlled tumor protein homolog OS=Fragaria ananassa GN=TCTP PE=2 SV=1 1 171 1.0E-36
sp|Q944W6|TCTP_BRAOL Translationally-controlled tumor protein homolog OS=Brassica oleracea GN=TCTP PE=2 SV=1 1 171 1.0E-36
sp|Q8H6A5|TCTP_MAIZE Translationally-controlled tumor protein homolog OS=Zea mays GN=TCTP PE=2 SV=1 1 171 1.0E-36
sp|Q7ZYF2|TCTP_XENLA Translationally-controlled tumor protein homolog OS=Xenopus laevis GN=tpt1 PE=1 SV=1 1 166 1.0E-36
sp|Q95WA2|TCTP_SCHMA Translationally-controlled tumor protein homolog (Fragment) OS=Schistosoma mansoni GN=TCTP PE=2 SV=1 1 167 3.0E-36
sp|Q5J907|TCTP_ELAGV Translationally-controlled tumor protein homolog OS=Elaeis guineensis var. tenera GN=TCTP PE=2 SV=1 1 171 3.0E-36
sp|P28014|TCTP_MEDSA Translationally-controlled tumor protein homolog OS=Medicago sativa GN=TCTP PE=2 SV=2 1 171 6.0E-36
sp|Q9ZSW9|TCTP_HEVBR Translationally-controlled tumor protein homolog OS=Hevea brasiliensis GN=TCTP PE=2 SV=1 1 171 2.0E-35
sp|Q9ZRX0|TCTP_PSEMZ Translationally-controlled tumor protein homolog OS=Pseudotsuga menziesii GN=TCTP PE=2 SV=1 1 171 2.0E-35
sp|Q6DUX3|TCTP_SOLLC Translationally-controlled tumor protein homolog OS=Solanum lycopersicum GN=TCTP PE=2 SV=1 1 171 3.0E-35
sp|P43349|TCTP_SOLTU Translationally-controlled tumor protein homolog OS=Solanum tuberosum GN=TCTP PE=2 SV=2 1 171 7.0E-35
sp|Q9M5I8|TCTP_CUCME Translationally-controlled tumor protein homolog OS=Cucumis melo GN=TCTP PE=2 SV=1 1 171 2.0E-34
sp|P50906|TCTP_PEA Translationally-controlled tumor protein homolog OS=Pisum sativum GN=TCTP PE=2 SV=2 1 171 2.0E-34
sp|Q944T2|TCTP_SOYBN Translationally-controlled tumor protein homolog OS=Glycine max GN=TCTP PE=2 SV=1 1 171 2.0E-33
sp|Q95VY2|TCTP_BRABE Translationally-controlled tumor protein homolog OS=Branchiostoma belcheri PE=2 SV=1 1 170 3.0E-33
sp|Q202I6|TCTP_SCOMX Translationally-controlled tumor protein homolog OS=Scophthalmus maximus GN=tpt1 PE=2 SV=1 1 166 3.0E-33
sp|M5B4R7|TCTP_GRARO Translationally-controlled tumor protein homolog OS=Grammostola rosea PE=2 SV=1 1 171 8.0E-33
sp|G3LU44|TCTP_LOXIN Translationally-controlled tumor protein homolog OS=Loxosceles intermedia PE=2 SV=1 1 171 2.0E-32
sp|Q9XHL7|TCTP_TOBAC Translationally-controlled tumor protein homolog OS=Nicotiana tabacum GN=TCTP PE=2 SV=1 1 171 3.0E-32
sp|Q6XIN1|TCTP_DROYA Translationally-controlled tumor protein homolog OS=Drosophila yakuba GN=Tctp PE=2 SV=1 1 171 2.0E-31
sp|Q293Y0|TCTP_DROPS Translationally-controlled tumor protein homolog OS=Drosophila pseudoobscura pseudoobscura GN=Tctp PE=3 SV=1 1 171 2.0E-31
sp|Q54RX6|TCTP1_DICDI Translationally-controlled tumor protein homolog 1 OS=Dictyostelium discoideum GN=DDB_G0282853 PE=3 SV=1 1 170 4.0E-31
sp|Q8LRM8|TCTP_WHEAT Translationally-controlled tumor protein homolog OS=Triticum aestivum GN=TCTP PE=2 SV=1 1 171 6.0E-31
sp|O18477|TCTP_LUMRU Translationally-controlled tumor protein homolog OS=Lumbricus rubellus GN=TCTP PE=2 SV=1 1 171 1.0E-30
sp|Q9VGS2|TCTP_DROME Translationally-controlled tumor protein homolog OS=Drosophila melanogaster GN=Tctp PE=1 SV=1 1 171 2.0E-30
sp|P35681|TCTP_ORYSJ Translationally-controlled tumor protein homolog OS=Oryza sativa subsp. japonica GN=TCTP PE=1 SV=1 1 171 7.0E-30
sp|Q1HR79|TCTP_AEDAE Translationally-controlled tumor protein homolog OS=Aedes aegypti GN=Tctp PE=2 SV=1 1 170 1.0E-29
sp|Q75VN3|TCTP_BOMMO Translationally-controlled tumor protein homolog OS=Bombyx mori GN=Tctp PE=2 SV=1 1 170 4.0E-29
sp|Q4PLZ3|TCTP_IXOSC Translationally-controlled tumor protein homolog OS=Ixodes scapularis GN=Tctp PE=2 SV=1 1 170 5.0E-29
sp|Q7QCK2|TCTP_ANOGA Translationally-controlled tumor protein homolog OS=Anopheles gambiae GN=Tctp PE=3 SV=2 1 170 8.0E-29
sp|Q60FS1|TCTP_PLUXY Translationally-controlled tumor protein homolog OS=Plutella xylostella GN=Tctp PE=2 SV=1 1 170 9.0E-29
sp|Q5MGM6|TCTP_LONON Translationally-controlled tumor protein homolog OS=Lonomia obliqua GN=Tctp PE=2 SV=1 1 170 1.0E-28
sp|Q5MIP6|TCTP_AEDAL Translationally-controlled tumor protein homolog OS=Aedes albopictus GN=Tctp PE=2 SV=1 1 170 2.0E-28
sp|Q54RX1|TCTP2_DICDI Translationally-controlled tumor protein homolog 2 OS=Dictyostelium discoideum GN=DDB_G0282861 PE=3 SV=1 1 171 2.0E-22
sp|Q962A2|TCTP_WUCBA Translationally-controlled tumor protein homolog OS=Wuchereria bancrofti PE=2 SV=1 1 170 6.0E-22
sp|P90697|TCTP_BRUMA Translationally-controlled tumor protein homolog OS=Brugia malayi PE=2 SV=1 1 170 6.0E-22
sp|Q8I3Z5|TCTP_PLAF7 Translationally-controlled tumor protein homolog OS=Plasmodium falciparum (isolate 3D7) GN=TCTP PE=1 SV=1 1 170 1.0E-21
sp|P84152|TCTP_PLAKN Translationally-controlled tumor protein homolog OS=Plasmodium knowlesi GN=TCTP PE=1 SV=1 1 170 2.0E-21
sp|Q4N938|TCTP_THEPA Translationally-controlled tumor protein homolog OS=Theileria parva GN=TCTP PE=3 SV=1 1 170 6.0E-20
sp|Q9M9V9|TCTP2_ARATH Translationally controlled tumor protein 2 OS=Arabidopsis thaliana GN=TCTP2 PE=1 SV=1 1 171 1.0E-19
sp|Q4YZC6|TCTP_PLABA Translationally-controlled tumor protein homolog OS=Plasmodium berghei (strain Anka) GN=TCTP PE=3 SV=1 1 170 2.0E-19
sp|Q9XYU2|TCTP_PLAYO Translationally-controlled tumor protein homolog OS=Plasmodium yoelii yoelii GN=TCTP PE=3 SV=2 1 170 3.0E-19
sp|Q4XFJ8|TCTP_PLACH Translationally-controlled tumor protein homolog OS=Plasmodium chabaudi GN=TCTP PE=3 SV=1 1 170 3.0E-19
sp|Q2L875|TCTP_TRIPS Translationally-controlled tumor protein homolog OS=Trichinella pseudospiralis PE=2 SV=1 1 166 2.0E-18
sp|Q4UGL5|TCTP_THEAN Translationally-controlled tumor protein homolog OS=Theileria annulata GN=TCTP PE=3 SV=1 1 170 1.0E-17
sp|Q622B7|TCTP_CAEBR Translationally-controlled tumor protein homolog OS=Caenorhabditis briggsae GN=tct-1 PE=3 SV=1 1 171 1.0E-14
sp|Q93573|TCTP_CAEEL Translationally-controlled tumor protein homolog OS=Caenorhabditis elegans GN=tct-1 PE=1 SV=1 1 171 2.0E-14
sp|Q56UQ5|TPT1L_HUMAN TPT1-like protein OS=Homo sapiens PE=2 SV=2 1 132 7.0E-14
sp|Q9HAU6|TCTP8_HUMAN Putative translationally-controlled tumor protein-like protein TPT1P8 OS=Homo sapiens GN=TPT1P8 PE=5 SV=2 1 102 9.0E-13
sp|Q8I8A2|TCTP_SCHHA Translationally-controlled tumor protein homolog (Fragment) OS=Schistosoma haematobium GN=TCTP PE=2 SV=2 13 150 2.0E-12
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2371
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|666 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|754
Ophiocordyceps camponoti-floridani Ophcf2|06022
Ophiocordyceps camponoti-rufipedis Ophun1|1254
Ophiocordyceps kimflemingae Ophio5|7115
Ophiocordyceps subramaniannii Hirsu2|3315

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|666
MIIFKDILTGDEVISDSYKLKEVDGIVYEADCAMITQEAVNVDTGANASAEGGDEEGVEDQAVKVNNIVHSFRLQ
STNFDKKGYLAYLKAYLKAVKAALQEKGESADTIAAFEKGAQTYVKEKLLPNFKDFEFYTGESMNPDGLVVLLNY
REDGVTPYVVVWKHGLTEMKV*
Coding >OphauG2|666
ATGATTATTTTCAAGGATATCCTCACAGGGGACGAGGTCATCTCGGACTCGTATAAACTCAAAGAGGTAGATGGC
ATTGTTTACGAGGCCGACTGCGCCATGATTACGCAGGAGGCCGTCAATGTTGATACTGGCGCCAATGCCTCGGCC
GAGGGCGGAGACGAGGAAGGTGTTGAGGACCAGGCAGTAAAGGTCAACAACATTGTGCACTCGTTCCGTCTGCAG
TCGACCAACTTTGACAAGAAGGGTTACCTGGCCTATCTCAAGGCCTACCTGAAGGCCGTCAAGGCTGCGCTCCAG
GAAAAAGGCGAGAGTGCCGACACCATTGCTGCATTCGAAAAAGGCGCCCAAACATACGTTAAGGAGAAGCTGCTA
CCCAACTTCAAGGACTTTGAGTTCTACACGGGCGAGTCTATGAACCCCGATGGGCTTGTCGTCCTCCTCAACTAT
CGCGAGGATGGCGTGACACCATATGTCGTTGTATGGAAGCACGGCCTCACGGAGATGAAGGTGTAA
Transcript >OphauG2|666
ATGATTATTTTCAAGGATATCCTCACAGGGGACGAGGTCATCTCGGACTCGTATAAACTCAAAGAGGTAGATGGC
ATTGTTTACGAGGCCGACTGCGCCATGATTACGCAGGAGGCCGTCAATGTTGATACTGGCGCCAATGCCTCGGCC
GAGGGCGGAGACGAGGAAGGTGTTGAGGACCAGGCAGTAAAGGTCAACAACATTGTGCACTCGTTCCGTCTGCAG
TCGACCAACTTTGACAAGAAGGGTTACCTGGCCTATCTCAAGGCCTACCTGAAGGCCGTCAAGGCTGCGCTCCAG
GAAAAAGGCGAGAGTGCCGACACCATTGCTGCATTCGAAAAAGGCGCCCAAACATACGTTAAGGAGAAGCTGCTA
CCCAACTTCAAGGACTTTGAGTTCTACACGGGCGAGTCTATGAACCCCGATGGGCTTGTCGTCCTCCTCAACTAT
CGCGAGGATGGCGTGACACCATATGTCGTTGTATGGAAGCACGGCCTCACGGAGATGAAGGTGTAA
Gene >OphauG2|666
ATGATTATTTTCAAGGTATTGCTCTGCACGCTTGTTTACTCCCCCGCACATTGGCCTGTGGCTGATGCGGCCATC
TCTTGCAGGATATCCTCACAGGGGACGAGGTCATCTCGGACTCGTATAAACTCAAAGAGGTAGATGGCATTGTTT
ACGAGGCCGACTGCGCCATGATTACGCAGGAGGCCGTCAATGTTGGTATGTTGAGCGCAACATGGCAGCTGTCAC
ATGCGCTGACTGGTGATGCAAGATACTGGCGCCAATGCCTCGGCCGAGGGCGGAGACGAGGAAGGTGTTGAGGAC
CAGGCAGTAAAGGTCAACAACATTGTGCACTCGTTCCGTCTGCAGTCGACCAACTTTGACAAGAAGGGTTACCTG
GCCTATCTCAAGGGTAAGCTTCTCCCACCTTGGAAACGAGCAAATATTTCTTTTTTCCCCCAACTAGCAATCACT
AACATACTGTCCTTTAGCCTACCTGAAGGCCGTCAAGGCTGCGCTCCAGGAAAAAGGCGAGAGTGCCGACACCAT
TGCTGCATTCGAAAAAGGCGCCCAAACATACGTTAAGGAGAAGCTGCTACCCAACTTCAAGGACTTTGAGTTCTA
CACGGGCGAGTCTATGAACCCCGATGGGCTGTACGTAACCCTTTGACTTGACTTTGATGCTCGAAATTATCATGG
TCTGTTGGCTAACCCATTGCTAGTGTCGTCCTCCTCAACTATCGCGAGGATGGCGTGACACCATATGTCGTTGTA
TGGAAGCACGGCCTCACGGAGATGAAGGTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail