Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6647
Gene name
LocationContig_70:10510..11307
Strand+
Gene length (bp)797
Transcript length (bp)573
Coding sequence length (bp)573
Protein length (aa) 191

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13499 EF-hand_7 EF-hand domain pair 2.4E-07 40 88
PF13499 EF-hand_7 EF-hand domain pair 1.1E-15 99 171
PF00036 EF-hand_1 EF hand 1.2E-06 66 90
PF00036 EF-hand_1 EF hand 2.4E-08 101 127
PF13405 EF-hand_6 EF-hand domain 2.2E-06 66 90
PF13202 EF-hand_5 EF hand 2.1E-04 66 85
PF13202 EF-hand_5 EF hand 2.9E-05 104 124
PF13202 EF-hand_5 EF hand 3.4E-04 150 171
PF13833 EF-hand_8 EF-hand domain pair 5.8E-05 40 86
PF13833 EF-hand_8 EF-hand domain pair 1.1E-03 98 123
PF13833 EF-hand_8 EF-hand domain pair 1.2E-02 130 173

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09711|NCS1_SCHPO Calcium-binding protein NCS-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ncs1 PE=1 SV=2 1 190 2.0E-108
sp|P62168|NCS1_RAT Neuronal calcium sensor 1 OS=Rattus norvegicus GN=Ncs1 PE=1 SV=2 1 190 2.0E-87
sp|Q8BNY6|NCS1_MOUSE Neuronal calcium sensor 1 OS=Mus musculus GN=Ncs1 PE=1 SV=3 1 190 2.0E-87
sp|P62166|NCS1_HUMAN Neuronal calcium sensor 1 OS=Homo sapiens GN=NCS1 PE=1 SV=2 1 190 2.0E-87
sp|P62167|NCS1_CHICK Neuronal calcium sensor 1 OS=Gallus gallus GN=NCS1 PE=1 SV=2 1 190 2.0E-87
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09711|NCS1_SCHPO Calcium-binding protein NCS-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ncs1 PE=1 SV=2 1 190 2.0E-108
sp|P62168|NCS1_RAT Neuronal calcium sensor 1 OS=Rattus norvegicus GN=Ncs1 PE=1 SV=2 1 190 2.0E-87
sp|Q8BNY6|NCS1_MOUSE Neuronal calcium sensor 1 OS=Mus musculus GN=Ncs1 PE=1 SV=3 1 190 2.0E-87
sp|P62166|NCS1_HUMAN Neuronal calcium sensor 1 OS=Homo sapiens GN=NCS1 PE=1 SV=2 1 190 2.0E-87
sp|P62167|NCS1_CHICK Neuronal calcium sensor 1 OS=Gallus gallus GN=NCS1 PE=1 SV=2 1 190 2.0E-87
sp|Q91614|NCS1_XENLA Neuronal calcium sensor 1 OS=Xenopus laevis GN=ncs1 PE=2 SV=2 1 190 2.0E-87
sp|Q5RC90|NCS1_PONAB Neuronal calcium sensor 1 OS=Pongo abelii GN=NCS1 PE=2 SV=3 1 190 4.0E-87
sp|Q2V8Y7|NCS1_BOVIN Neuronal calcium sensor 1 OS=Bos taurus GN=NCS1 PE=1 SV=3 1 190 5.0E-86
sp|Q06389|NCS1_YEAST Calcium-binding protein NCS-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRQ1 PE=1 SV=2 1 190 3.0E-85
sp|P36608|NCS1_CAEEL Neuronal calcium sensor 1 OS=Caenorhabditis elegans GN=ncs-1 PE=2 SV=2 1 189 8.0E-85
sp|P42325|NCAH_DROME Neurocalcin homolog OS=Drosophila melanogaster GN=Nca PE=1 SV=2 1 183 4.0E-80
sp|Q16981|NCS1_APLCA Neuronal calcium sensor 1 OS=Aplysia californica PE=2 SV=2 1 187 3.0E-79
sp|Q16982|NECX_APLCA Neurocalcin OS=Aplysia californica PE=2 SV=2 1 183 7.0E-79
sp|Q3YLA4|NCS1_LYMST Neuronal calcium sensor 1 OS=Lymnaea stagnalis PE=2 SV=2 1 187 2.0E-78
sp|B5FZ84|HPCL1_TAEGU Hippocalcin-like protein 1 OS=Taeniopygia guttata GN=HPCAL1 PE=2 SV=1 1 183 5.0E-78
sp|P42324|HPCL1_CHICK Hippocalcin-like protein 1 OS=Gallus gallus GN=HPCAL1 PE=1 SV=2 1 183 5.0E-78
sp|P62749|HPCL1_RAT Hippocalcin-like protein 1 OS=Rattus norvegicus GN=Hpcal1 PE=1 SV=2 1 183 9.0E-78
sp|P62748|HPCL1_MOUSE Hippocalcin-like protein 1 OS=Mus musculus GN=Hpcal1 PE=1 SV=2 1 183 9.0E-78
sp|P84076|HPCA_RAT Neuron-specific calcium-binding protein hippocalcin OS=Rattus norvegicus GN=Hpca PE=1 SV=2 1 183 1.0E-77
sp|Q06AT1|HPCA_PIG Neuron-specific calcium-binding protein hippocalcin OS=Sus scrofa GN=HPCA PE=2 SV=3 1 183 1.0E-77
sp|P84075|HPCA_MOUSE Neuron-specific calcium-binding protein hippocalcin OS=Mus musculus GN=Hpca PE=1 SV=2 1 183 1.0E-77
sp|P84074|HPCA_HUMAN Neuron-specific calcium-binding protein hippocalcin OS=Homo sapiens GN=HPCA PE=1 SV=2 1 183 1.0E-77
sp|Q4PL64|HPCA_BOVIN Neuron-specific calcium-binding protein hippocalcin OS=Bos taurus GN=HPCA PE=2 SV=3 1 183 1.0E-77
sp|B3VSB7|HPCL1_SHEEP Hippocalcin-like protein 1 OS=Ovis aries GN=HPCAL1 PE=2 SV=1 1 183 2.0E-77
sp|Q06AT0|HPCL1_PIG Hippocalcin-like protein 1 OS=Sus scrofa GN=HPCAL1 PE=2 SV=3 1 183 2.0E-77
sp|P29105|HPCL1_BOVIN Hippocalcin-like protein 1 OS=Bos taurus GN=HPCAL1 PE=1 SV=4 1 183 2.0E-77
sp|P37235|HPCL1_HUMAN Hippocalcin-like protein 1 OS=Homo sapiens GN=HPCAL1 PE=1 SV=3 1 183 2.0E-77
sp|Q28IM6|HPCL1_XENTR Hippocalcin-like protein 1 OS=Xenopus tropicalis GN=hpcal1 PE=2 SV=1 1 183 3.0E-77
sp|Q6DCM9|HPCL1_XENLA Hippocalcin-like protein 1 OS=Xenopus laevis GN=hpcal1 PE=2 SV=1 1 183 3.0E-77
sp|B3DLU1|NCALD_XENTR Neurocalcin-delta OS=Xenopus tropicalis GN=ncald PE=2 SV=1 1 183 4.0E-77
sp|Q7SY75|NCALD_XENLA Neurocalcin-delta OS=Xenopus laevis GN=ncald PE=2 SV=1 1 183 5.0E-77
sp|A9JTH1|NCLDA_DANRE Neurocalcin-delta A OS=Danio rerio GN=ncalda PE=2 SV=1 1 183 9.0E-77
sp|P62759|NCALD_TAEGU Neurocalcin-delta OS=Taeniopygia guttata GN=NCALD PE=2 SV=2 1 183 1.0E-76
sp|P62758|NCALD_CHICK Neurocalcin-delta OS=Gallus gallus GN=NCALD PE=2 SV=2 1 183 1.0E-76
sp|Q5PQN0|NCALD_RAT Neurocalcin-delta OS=Rattus norvegicus GN=Ncald PE=1 SV=3 1 183 1.0E-76
sp|Q91X97|NCALD_MOUSE Neurocalcin-delta OS=Mus musculus GN=Ncald PE=1 SV=4 1 183 1.0E-76
sp|Q4R4N4|NCALD_MACFA Neurocalcin-delta OS=Macaca fascicularis GN=NCALD PE=2 SV=3 1 183 1.0E-76
sp|P61601|NCALD_HUMAN Neurocalcin-delta OS=Homo sapiens GN=NCALD PE=1 SV=2 1 183 1.0E-76
sp|P61602|NCALD_BOVIN Neurocalcin-delta OS=Bos taurus GN=NCALD PE=1 SV=2 1 183 1.0E-76
sp|Q5R632|HPCL1_PONAB Hippocalcin-like protein 1 OS=Pongo abelii GN=HPCAL1 PE=2 SV=3 1 183 4.0E-76
sp|Q5RAH1|NCALD_PONAB Neurocalcin-delta OS=Pongo abelii GN=NCALD PE=2 SV=3 1 183 2.0E-75
sp|P62762|VISL1_RAT Visinin-like protein 1 OS=Rattus norvegicus GN=Vsnl1 PE=1 SV=2 1 183 2.0E-74
sp|Q5RD22|VISL1_PONAB Visinin-like protein 1 OS=Pongo abelii GN=VSNL1 PE=2 SV=3 1 183 2.0E-74
sp|P62761|VISL1_MOUSE Visinin-like protein 1 OS=Mus musculus GN=Vsnl1 PE=1 SV=2 1 183 2.0E-74
sp|Q4R5F7|VISL1_MACFA Visinin-like protein 1 OS=Macaca fascicularis GN=VSNL1 PE=2 SV=3 1 183 2.0E-74
sp|P62760|VISL1_HUMAN Visinin-like protein 1 OS=Homo sapiens GN=VSNL1 PE=1 SV=2 1 183 2.0E-74
sp|P62764|VISL1_CHICK Visinin-like protein 1 OS=Gallus gallus GN=VSNL1 PE=2 SV=2 1 183 2.0E-74
sp|P62763|VISL1_BOVIN Visinin-like protein 1 OS=Bos taurus GN=VSNL1 PE=1 SV=2 1 183 2.0E-74
sp|Q6AXL4|NCLDB_DANRE Neurocalcin-delta B OS=Danio rerio GN=ncaldb PE=2 SV=1 1 183 5.0E-74
sp|P35332|HPCL4_RAT Hippocalcin-like protein 4 OS=Rattus norvegicus GN=Hpcal4 PE=2 SV=2 1 183 1.0E-73
sp|Q5R6S5|HPCL4_PONAB Hippocalcin-like protein 4 OS=Pongo abelii GN=HPCAL4 PE=2 SV=3 1 183 3.0E-73
sp|Q9UM19|HPCL4_HUMAN Hippocalcin-like protein 4 OS=Homo sapiens GN=HPCAL4 PE=1 SV=3 1 183 3.0E-73
sp|P29104|HPCL4_BOVIN Hippocalcin-like protein 4 OS=Bos taurus GN=HPCAL4 PE=1 SV=3 1 183 3.0E-73
sp|Q8BGZ1|HPCL4_MOUSE Hippocalcin-like protein 4 OS=Mus musculus GN=Hpcal4 PE=1 SV=3 1 183 5.0E-73
sp|P37236|FREQ_DROME Frequenin-1 OS=Drosophila melanogaster GN=Frq1 PE=2 SV=2 1 188 1.0E-71
sp|Q8MIH6|RECO_CANLF Recoverin OS=Canis lupus familiaris GN=RCVRN PE=3 SV=1 1 180 2.0E-57
sp|P21457|RECO_BOVIN Recoverin OS=Bos taurus GN=RCVRN PE=1 SV=3 1 180 2.0E-57
sp|P35243|RECO_HUMAN Recoverin OS=Homo sapiens GN=RCVRN PE=1 SV=2 1 183 1.0E-55
sp|P34057|RECO_MOUSE Recoverin OS=Mus musculus GN=Rcvrn PE=2 SV=2 1 183 1.0E-55
sp|P36609|NCS2_CAEEL Neuronal calcium sensor 2 OS=Caenorhabditis elegans GN=ncs-2 PE=2 SV=2 4 184 3.0E-55
sp|P31227|SMOD_LITCT S-modulin OS=Lithobates catesbeiana PE=1 SV=4 1 183 6.0E-53
sp|Q9JJ57|KCIP1_MOUSE Kv channel-interacting protein 1 OS=Mus musculus GN=Kcnip1 PE=1 SV=2 11 190 2.0E-52
sp|Q8R426|KCIP1_RAT Kv channel-interacting protein 1 OS=Rattus norvegicus GN=Kcnip1 PE=1 SV=2 11 190 2.0E-52
sp|Q99MG9|KCIP4_RAT Kv channel-interacting protein 4 OS=Rattus norvegicus GN=Kcnip4 PE=1 SV=1 11 190 4.0E-52
sp|Q6PHZ8|KCIP4_MOUSE Kv channel-interacting protein 4 OS=Mus musculus GN=Kcnip4 PE=1 SV=1 11 190 4.0E-52
sp|Q8HYN7|KCIP4_MACFA Kv channel-interacting protein 4 OS=Macaca fascicularis GN=KCNIP4 PE=2 SV=1 11 190 5.0E-52
sp|Q6PIL6|KCIP4_HUMAN Kv channel-interacting protein 4 OS=Homo sapiens GN=KCNIP4 PE=1 SV=1 11 190 5.0E-52
sp|Q9NZI2|KCIP1_HUMAN Kv channel-interacting protein 1 OS=Homo sapiens GN=KCNIP1 PE=1 SV=2 11 190 9.0E-52
sp|Q8WN03|KCIP2_MUSPF Kv channel-interacting protein 2 OS=Mustela putorius furo GN=Kcnip2 PE=2 SV=1 6 190 2.0E-51
sp|Q9NS61|KCIP2_HUMAN Kv channel-interacting protein 2 OS=Homo sapiens GN=KCNIP2 PE=1 SV=3 6 190 2.0E-51
sp|Q2KI69|KCIP4_BOVIN Kv channel-interacting protein 4 OS=Bos taurus GN=KCNIP4 PE=2 SV=1 11 190 2.0E-51
sp|Q9JM47|CSEN_RAT Calsenilin OS=Rattus norvegicus GN=Kcnip3 PE=1 SV=1 11 190 4.0E-51
sp|Q9Y2W7|CSEN_HUMAN Calsenilin OS=Homo sapiens GN=KCNIP3 PE=1 SV=1 11 190 4.0E-51
sp|Q17QD9|CSEN_BOVIN Calsenilin OS=Bos taurus GN=KCNIP3 PE=2 SV=1 11 190 5.0E-51
sp|Q9JJ69|KCIP2_MOUSE Kv channel-interacting protein 2 OS=Mus musculus GN=Kcnip2 PE=1 SV=2 6 190 5.0E-51
sp|Q9JM59|KCIP2_RAT Kv channel-interacting protein 2 OS=Rattus norvegicus GN=Kcnip2 PE=1 SV=2 6 190 1.0E-50
sp|Q9QXT8|CSEN_MOUSE Calsenilin OS=Mus musculus GN=Kcnip3 PE=1 SV=2 11 190 1.0E-50
sp|P22728|VISI_CHICK Visinin OS=Gallus gallus PE=2 SV=5 1 183 8.0E-50
sp|Q75K28|NCSA_DICDI Calcium-binding protein NCSA OS=Dictyostelium discoideum GN=ncsA PE=1 SV=2 1 187 4.0E-43
sp|O73763|GCIP_LITPI Guanylyl cyclase inhibitory protein OS=Lithobates pipiens GN=GCIP PE=2 SV=3 26 179 4.0E-37
sp|O73762|GUC1B_LITPI Guanylyl cyclase-activating protein 2 OS=Lithobates pipiens GN=GUCA1B PE=2 SV=3 11 185 2.0E-36
sp|P79881|GUC1B_CHICK Guanylyl cyclase-activating protein 2 OS=Gallus gallus GN=GUCA1B PE=2 SV=3 20 185 5.0E-36
sp|Q9UMX6|GUC1B_HUMAN Guanylyl cyclase-activating protein 2 OS=Homo sapiens GN=GUCA1B PE=1 SV=4 15 185 2.0E-35
sp|P51177|GUC1B_BOVIN Guanylyl cyclase-activating protein 2 OS=Bos taurus GN=GUCA1B PE=1 SV=2 7 185 1.0E-34
sp|Q8VBV8|GUC1B_MOUSE Guanylyl cyclase-activating protein 2 OS=Mus musculus GN=Guca1b PE=2 SV=3 15 185 3.0E-33
sp|P43080|GUC1A_HUMAN Guanylyl cyclase-activating protein 1 OS=Homo sapiens GN=GUCA1A PE=1 SV=3 26 184 2.0E-31
sp|O73761|GUC1A_LITPI Guanylyl cyclase-activating protein 1 OS=Lithobates pipiens GN=GUCA1A PE=2 SV=3 26 184 3.0E-31
sp|P46065|GUC1A_BOVIN Guanylyl cyclase-activating protein 1 OS=Bos taurus GN=GUCA1A PE=1 SV=2 26 184 6.0E-31
sp|P43081|GUC1A_MOUSE Guanylyl cyclase-activating protein 1 OS=Mus musculus GN=Guca1a PE=2 SV=3 12 184 1.0E-30
sp|P79880|GUC1A_CHICK Guanylyl cyclase-activating protein 1 OS=Gallus gallus GN=GUCA1A PE=1 SV=3 26 184 5.0E-30
sp|O95843|GUC1C_HUMAN Guanylyl cyclase-activating protein 3 OS=Homo sapiens GN=GUCA1C PE=1 SV=3 25 180 4.0E-24
sp|P42322|CANB1_NAEGR Calcineurin subunit B OS=Naegleria gruberi GN=CNB1 PE=3 SV=1 1 169 4.0E-21
sp|Q54LX0|CBPM_DICDI Calcium-binding protein M OS=Dictyostelium discoideum GN=cbpM PE=1 SV=1 1 185 2.0E-20
sp|Q874T7|CANB_KLULA Calcineurin subunit B OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CNB1 PE=3 SV=1 1 181 2.0E-19
sp|P25296|CANB_YEAST Calcineurin subunit B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CNB1 PE=1 SV=3 1 187 4.0E-19
sp|Q757B7|CANB_ASHGO Calcineurin subunit B OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CNB1 PE=3 SV=1 1 185 4.0E-19
sp|Q6FLU4|CANB_CANGA Calcineurin subunit B OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CNB1 PE=3 SV=1 1 185 7.0E-19
sp|Q9UU93|CANB_SCHPO Calcineurin subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cnb1 PE=3 SV=1 1 171 1.0E-18
sp|Q6BWS8|CANB_DEBHA Calcineurin subunit B OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CNB1 PE=3 SV=1 1 185 2.0E-18
sp|Q3HRP0|CNBL7_ORYSJ Calcineurin B-like protein 7 OS=Oryza sativa subsp. japonica GN=CBL7 PE=2 SV=1 10 185 3.0E-17
sp|Q55G87|CANB1_DICDI Calcineurin subunit B type 1 OS=Dictyostelium discoideum GN=cnbA PE=1 SV=1 1 185 4.0E-17
sp|Q86A72|Y4781_DICDI Recoverin family protein DDB_G0274781 OS=Dictyostelium discoideum GN=DDB_G0274781 PE=3 SV=1 2 180 8.0E-17
sp|Q6DN52|CBPL_DICDI Calcium-binding protein L OS=Dictyostelium discoideum GN=cbpL PE=2 SV=1 1 186 4.0E-16
sp|Q3HRN9|CNBL8_ORYSJ Calcineurin B-like protein 8 OS=Oryza sativa subsp. japonica GN=CBL8 PE=2 SV=1 10 185 5.0E-16
sp|P0CM54|CANB_CRYNJ Calcineurin subunit B OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNB1 PE=2 SV=1 1 171 5.0E-16
sp|P0CM55|CANB_CRYNB Calcineurin subunit B OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNB1 PE=3 SV=1 1 171 5.0E-16
sp|Q3HRN8|CNBL9_ORYSJ Calcineurin B-like protein 9 OS=Oryza sativa subsp. japonica GN=CBL9 PE=2 SV=2 1 185 1.0E-15
sp|Q43531|CCAMK_LILLO Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lilium longiflorum GN=CCAMK PE=1 SV=1 4 179 1.0E-15
sp|Q63811|CANB2_MOUSE Calcineurin subunit B type 2 OS=Mus musculus GN=Ppp3r2 PE=1 SV=3 14 190 3.0E-15
sp|P87072|CANB_NEUCR Calcineurin subunit B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cnb-1 PE=2 SV=2 1 169 3.0E-15
sp|P63100|CANB1_RAT Calcineurin subunit B type 1 OS=Rattus norvegicus GN=Ppp3r1 PE=1 SV=2 8 169 6.0E-15
sp|Q63810|CANB1_MOUSE Calcineurin subunit B type 1 OS=Mus musculus GN=Ppp3r1 PE=1 SV=3 8 169 6.0E-15
sp|P63098|CANB1_HUMAN Calcineurin subunit B type 1 OS=Homo sapiens GN=PPP3R1 PE=1 SV=2 8 169 6.0E-15
sp|P63099|CANB1_BOVIN Calcineurin subunit B type 1 OS=Bos taurus GN=PPP3R1 PE=1 SV=2 8 169 6.0E-15
sp|P28470|CANB2_RAT Calcineurin subunit B type 2 OS=Rattus norvegicus GN=Ppp3r2 PE=2 SV=2 19 190 7.0E-15
sp|Q6RET7|CCAMK_MEDTR Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase DMI-3 OS=Medicago truncatula GN=DMI3 PE=2 SV=1 64 179 8.0E-15
sp|P48451|CANB1_DROME Calcineurin subunit B type 1 OS=Drosophila melanogaster GN=CanB PE=2 SV=1 8 169 9.0E-15
sp|Q24214|CANB2_DROME Calcineurin subunit B type 2 OS=Drosophila melanogaster GN=CanB2 PE=1 SV=2 8 169 1.0E-14
sp|Q7FRS8|CNBLA_ARATH Calcineurin B-like protein 10 OS=Arabidopsis thaliana GN=CBL10 PE=1 SV=1 2 185 2.0E-14
sp|Q6RET6|CCAMK_PEA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase (Fragment) OS=Pisum sativum GN=SYM9 PE=1 SV=2 8 179 2.0E-14
sp|O81223|CNBL4_ARATH Calcineurin B-like protein 4 OS=Arabidopsis thaliana GN=CBL4 PE=1 SV=3 16 185 2.0E-14
sp|Q6AVM3|CCAMK_ORYSJ Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Oryza sativa subsp. japonica GN=CCAMK PE=2 SV=1 8 179 3.0E-14
sp|Q8LEM7|CNBL3_ARATH Calcineurin B-like protein 3 OS=Arabidopsis thaliana GN=CBL3 PE=1 SV=2 16 185 3.0E-14
sp|Q6CGE6|CANB_YARLI Calcineurin subunit B OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CNB1 PE=3 SV=1 12 170 3.0E-14
sp|A0AAR7|CCAMK_LOTJA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lotus japonicus GN=CCAMK PE=1 SV=1 8 179 4.0E-14
sp|Q9C5P6|CNBL6_ARATH Calcineurin B-like protein 6 OS=Arabidopsis thaliana GN=CBL6 PE=1 SV=2 15 185 4.0E-14
sp|Q2TBI5|CANB2_BOVIN Calcineurin subunit B type 2 OS=Bos taurus GN=PPP3R2 PE=2 SV=3 19 190 7.0E-14
sp|Q3HRP1|CNBL6_ORYSJ Calcineurin B-like protein 6 OS=Oryza sativa subsp. japonica GN=CBL6 PE=2 SV=1 16 185 9.0E-14
sp|Q9HAE3|EFCB1_HUMAN EF-hand calcium-binding domain-containing protein 1 OS=Homo sapiens GN=EFCAB1 PE=2 SV=1 4 180 1.0E-13
sp|O81445|CNBL1_ARATH Calcineurin B-like protein 1 OS=Arabidopsis thaliana GN=CBL1 PE=1 SV=3 1 185 1.0E-13
sp|Q75LU8|CNBL3_ORYSJ Calcineurin B-like protein 3 OS=Oryza sativa subsp. japonica GN=CBL3 PE=1 SV=1 16 185 2.0E-13
sp|Q9LTB8|CNBL9_ARATH Calcineurin B-like protein 9 OS=Arabidopsis thaliana GN=CBL9 PE=1 SV=3 10 185 2.0E-13
sp|Q96LZ3|CANB2_HUMAN Calcineurin subunit B type 2 OS=Homo sapiens GN=PPP3R2 PE=1 SV=3 19 169 3.0E-13
sp|Q3HRP5|CNBL2_ORYSJ Calcineurin B-like protein 2 OS=Oryza sativa subsp. japonica GN=CBL2 PE=2 SV=1 16 185 3.0E-13
sp|Q8LAS7|CNBL2_ARATH Calcineurin B-like protein 2 OS=Arabidopsis thaliana GN=CBL2 PE=1 SV=2 16 185 3.0E-13
sp|Q86IV8|CBPKL_DICDI Calcium-binding protein K-like OS=Dictyostelium discoideum GN=DDB_G0274357 PE=3 SV=1 5 135 9.0E-13
sp|Q32L26|EFCB1_BOVIN EF-hand calcium-binding domain-containing protein 1 OS=Bos taurus GN=EFCAB1 PE=2 SV=1 43 180 1.0E-12
sp|Q9D3N2|EFCB1_MOUSE EF-hand calcium-binding domain-containing protein 1 OS=Mus musculus GN=Efcab1 PE=2 SV=1 4 184 1.0E-12
sp|Q3HRN7|CNBLA_ORYSJ Calcineurin B-like protein 10 OS=Oryza sativa subsp. japonica GN=CBL10 PE=2 SV=1 8 185 3.0E-12
sp|Q7XC27|CNBL1_ORYSJ Calcineurin B-like protein 1 OS=Oryza sativa subsp. japonica GN=CBL1 PE=2 SV=2 5 185 7.0E-12
sp|Q3KQ77|EFCB1_XENLA EF-hand calcium-binding domain-containing protein 1 OS=Xenopus laevis GN=efcab1 PE=2 SV=1 1 182 4.0E-11
sp|Q75KU4|CNBL4_ORYSJ Calcineurin B-like protein 4 OS=Oryza sativa subsp. japonica GN=CBL4 PE=1 SV=1 41 185 5.0E-11
sp|Q86IV7|CBPK_DICDI Calcium-binding protein K OS=Dictyostelium discoideum GN=cbpK PE=3 SV=2 5 187 6.0E-11
sp|P61023|CHP1_RAT Calcineurin B homologous protein 1 OS=Rattus norvegicus GN=Chp1 PE=1 SV=2 1 133 1.0E-10
sp|P61022|CHP1_MOUSE Calcineurin B homologous protein 1 OS=Mus musculus GN=Chp1 PE=1 SV=2 1 133 1.0E-10
sp|Q3HRP2|CNBL5_ORYSJ Calcineurin B-like protein 5 OS=Oryza sativa subsp. japonica GN=CBL5 PE=2 SV=1 1 185 2.0E-10
sp|Q86JE1|Y2130_DICDI Recoverin family protein DDB_G0272130 OS=Dictyostelium discoideum GN=DDB_G0272130 PE=1 SV=1 1 169 2.0E-10
sp|Q55C62|CBPJ_DICDI Calcium-binding protein J OS=Dictyostelium discoideum GN=cbpJ PE=1 SV=1 1 125 2.0E-10
sp|P19123|TNNC1_MOUSE Troponin C, slow skeletal and cardiac muscles OS=Mus musculus GN=Tnnc1 PE=1 SV=1 7 171 3.0E-10
sp|Q3SYS6|CHP1_BOVIN Calcineurin B homologous protein 1 OS=Bos taurus GN=CHP1 PE=2 SV=1 1 133 5.0E-10
sp|Q9FUQ7|CNBL8_ARATH Calcineurin B-like protein 8 OS=Arabidopsis thaliana GN=CBL8 PE=1 SV=1 16 185 5.0E-10
sp|Q5R7F0|CHP1_PONAB Calcineurin B homologous protein 1 OS=Pongo abelii GN=CHP1 PE=2 SV=3 1 133 5.0E-10
sp|Q99653|CHP1_HUMAN Calcineurin B homologous protein 1 OS=Homo sapiens GN=CHP1 PE=1 SV=3 1 133 5.0E-10
sp|P02591|TNNC1_RABIT Troponin C, slow skeletal and cardiac muscles OS=Oryctolagus cuniculus GN=TNNC1 PE=1 SV=1 7 171 6.0E-10
sp|P63316|TNNC1_HUMAN Troponin C, slow skeletal and cardiac muscles OS=Homo sapiens GN=TNNC1 PE=1 SV=1 7 171 6.0E-10
sp|Q54WR4|PLDB_DICDI Phospholipase D B OS=Dictyostelium discoideum GN=pldB PE=2 SV=1 20 128 6.0E-10
sp|Q502J0|PCAT2_DANRE Lysophosphatidylcholine acyltransferase 2 OS=Danio rerio GN=lpcat2 PE=2 SV=1 24 170 1.0E-09
sp|Q96PH1|NOX5_HUMAN NADPH oxidase 5 OS=Homo sapiens GN=NOX5 PE=1 SV=1 62 185 1.0E-09
sp|P09860|TNNC1_CHICK Troponin C, slow skeletal and cardiac muscles OS=Gallus gallus GN=TNNC1 PE=1 SV=1 7 171 2.0E-09
sp|Q9SUA6|CNBL7_ARATH Calcineurin B-like protein 7 OS=Arabidopsis thaliana GN=CBL7 PE=1 SV=1 38 185 2.0E-09
sp|P63317|TNNC1_PIG Troponin C, slow skeletal and cardiac muscles OS=Sus scrofa GN=TNNC1 PE=1 SV=1 7 171 2.0E-09
sp|P63315|TNNC1_BOVIN Troponin C, slow skeletal and cardiac muscles OS=Bos taurus GN=TNNC1 PE=1 SV=1 7 171 2.0E-09
sp|Q54MF3|CANB2_DICDI Calcineurin subunit B type 2 OS=Dictyostelium discoideum GN=cnbB PE=3 SV=1 1 134 3.0E-09
sp|Q9Z0F4|CIB1_MOUSE Calcium and integrin-binding protein 1 OS=Mus musculus GN=Cib1 PE=1 SV=3 1 185 2.0E-08
sp|Q8NFA0|UBP32_HUMAN Ubiquitin carboxyl-terminal hydrolase 32 OS=Homo sapiens GN=USP32 PE=1 SV=1 55 170 2.0E-08
sp|P24044|CALM_PLAFA Calmodulin OS=Plasmodium falciparum PE=3 SV=4 7 169 2.0E-08
sp|P62203|CALM_PLAF7 Calmodulin OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0323 PE=3 SV=2 7 169 2.0E-08
sp|P05936|TNNC1_COTJA Troponin C, slow skeletal and cardiac muscles OS=Coturnix coturnix japonica GN=TNNC1 PE=2 SV=1 7 169 2.0E-08
sp|P04352|CALM_CHLRE Calmodulin OS=Chlamydomonas reinhardtii PE=1 SV=2 11 169 4.0E-08
sp|Q06850|CDPK1_ARATH Calcium-dependent protein kinase 1 OS=Arabidopsis thaliana GN=CPK1 PE=1 SV=1 40 169 4.0E-08
sp|P07463|CALM_PARTE Calmodulin OS=Paramecium tetraurelia GN=CAM PE=1 SV=3 11 169 4.0E-08
sp|Q5ZCK5|CML16_ORYSJ Probable calcium-binding protein CML16 OS=Oryza sativa subsp. japonica GN=CML16 PE=2 SV=1 4 176 6.0E-08
sp|P61859|CALM_NEUCR Calmodulin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cmd-1 PE=1 SV=2 8 169 7.0E-08
sp|Q9UWF0|CALM_MAGO7 Calmodulin OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CMD1 PE=3 SV=4 8 169 7.0E-08
sp|P61860|CALM_COLTR Calmodulin OS=Colletotrichum trifolii PE=3 SV=2 8 169 7.0E-08
sp|P61861|CALM_COLGL Calmodulin OS=Colletotrichum gloeosporioides PE=2 SV=2 8 169 7.0E-08
sp|Q99828|CIB1_HUMAN Calcium and integrin-binding protein 1 OS=Homo sapiens GN=CIB1 PE=1 SV=4 1 185 7.0E-08
sp|B1A8Z2|CIB1_SHEEP Calcium and integrin-binding protein 1 OS=Ovis aries GN=CIB1 PE=2 SV=1 1 182 7.0E-08
sp|Q17QE5|CIB1_BOVIN Calcium and integrin-binding protein 1 OS=Bos taurus GN=CIB1 PE=2 SV=1 1 182 7.0E-08
sp|Q9R010|CIB1_RAT Calcium and integrin-binding protein 1 OS=Rattus norvegicus GN=Cib1 PE=1 SV=3 1 185 8.0E-08
sp|Q9HFY6|CALM_BLAEM Calmodulin OS=Blastocladiella emersonii GN=CMD1 PE=3 SV=3 11 169 9.0E-08
sp|Q9LF55|CML32_ARATH Probable calcium-binding protein CML32 OS=Arabidopsis thaliana GN=CML32 PE=2 SV=1 41 170 9.0E-08
sp|P60204|CALM_EMENI Calmodulin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=camA PE=3 SV=2 8 169 1.0E-07
sp|P60205|CALM_ASPOR Calmodulin OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cmdA PE=3 SV=2 8 169 1.0E-07
sp|P60206|CALM_AJECG Calmodulin OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=CAM1 PE=2 SV=2 8 169 1.0E-07
sp|Q9NJU9|CDPK3_PLAF7 Calcium-dependent protein kinase 3 OS=Plasmodium falciparum (isolate 3D7) GN=CPK3 PE=1 SV=1 41 171 1.0E-07
sp|P11118|CALM_EUGGR Calmodulin OS=Euglena gracilis PE=1 SV=2 8 169 2.0E-07
sp|Q8CIY2|DUOX1_RAT Dual oxidase 1 OS=Rattus norvegicus GN=Duox1 PE=1 SV=1 64 160 2.0E-07
sp|O43745|CHP2_HUMAN Calcineurin B homologous protein 2 OS=Homo sapiens GN=CHP2 PE=1 SV=3 16 169 2.0E-07
sp|Q8X187|CALM_PAXIN Calmodulin OS=Paxillus involutus GN=calA PE=2 SV=3 7 169 2.0E-07
sp|Q9Y6T7|DGKB_HUMAN Diacylglycerol kinase beta OS=Homo sapiens GN=DGKB PE=2 SV=2 80 172 2.0E-07
sp|O94739|CALM_PLEOS Calmodulin OS=Pleurotus ostreatus GN=CMD1 PE=2 SV=3 7 169 2.0E-07
sp|Q5ZM44|CHP1_CHICK Calcineurin B homologous protein 1 OS=Gallus gallus GN=CHP1 PE=1 SV=3 9 133 3.0E-07
sp|P11120|CALM_PLECO Calmodulin OS=Pleurotus cornucopiae GN=CMD1 PE=1 SV=2 7 169 3.0E-07
sp|A8CEP3|CALM_SACJA Calmodulin OS=Saccharina japonica GN=cam PE=2 SV=1 11 169 4.0E-07
sp|P02599|CALM_DICDI Calmodulin OS=Dictyostelium discoideum GN=calA PE=1 SV=3 9 169 4.0E-07
sp|Q8HZK2|DUOX2_PIG Dual oxidase 2 OS=Sus scrofa GN=DUOX2 PE=1 SV=2 64 131 4.0E-07
sp|P84339|CALM_AGABI Calmodulin OS=Agaricus bisporus PE=1 SV=2 7 169 5.0E-07
sp|Q38870|CDPK2_ARATH Calcium-dependent protein kinase 2 OS=Arabidopsis thaliana GN=CPK2 PE=1 SV=1 27 169 5.0E-07
sp|Q9NRD9|DUOX1_HUMAN Dual oxidase 1 OS=Homo sapiens GN=DUOX1 PE=1 SV=1 64 164 5.0E-07
sp|A8I1Q0|CALM_HETTR Calmodulin OS=Heterocapsa triquetra PE=2 SV=1 11 169 5.0E-07
sp|Q4V8A1|PCT2B_RAT Lysophosphatidylcholine acyltransferase 2B OS=Rattus norvegicus GN=Lpcat2b PE=2 SV=1 20 129 5.0E-07
sp|P02598|CALM_TETPY Calmodulin OS=Tetrahymena pyriformis PE=1 SV=4 11 169 5.0E-07
sp|Q9MZF4|DUOX1_CANLF Dual oxidase 1 OS=Canis lupus familiaris GN=DUOX1 PE=1 SV=1 64 160 5.0E-07
sp|O88673|DGKA_MOUSE Diacylglycerol kinase alpha OS=Mus musculus GN=Dgka PE=1 SV=2 1 185 6.0E-07
sp|P69098|CALM_TRYBG Calmodulin OS=Trypanosoma brucei gambiense PE=3 SV=2 7 169 6.0E-07
sp|P69097|CALM_TRYBB Calmodulin OS=Trypanosoma brucei brucei PE=3 SV=2 7 169 6.0E-07
sp|Q8HZK3|DUOX1_PIG Dual oxidase 1 OS=Sus scrofa GN=DUOX1 PE=2 SV=1 64 131 7.0E-07
sp|Q0IUU4|CML2_ORYSJ Putative calmodulin-like protein 2 OS=Oryza sativa subsp. japonica GN=CML2 PE=3 SV=2 68 170 8.0E-07
sp|P49621|DGKB_RAT Diacylglycerol kinase beta OS=Rattus norvegicus GN=Dgkb PE=1 SV=1 79 189 8.0E-07
sp|P14533|CABO_DORPE Squidulin OS=Doryteuthis pealeii PE=1 SV=1 68 171 8.0E-07
sp|P10246|TNNC2_MELGA Troponin C, skeletal muscle OS=Meleagris gallopavo GN=TNNC2 PE=1 SV=2 66 169 8.0E-07
sp|Q6NS52|DGKB_MOUSE Diacylglycerol kinase beta OS=Mus musculus GN=Dgkb PE=1 SV=2 79 189 9.0E-07
sp|Q9NZT1|CALL5_HUMAN Calmodulin-like protein 5 OS=Homo sapiens GN=CALML5 PE=1 SV=2 72 169 9.0E-07
sp|O97341|CALM_SUBDO Calmodulin OS=Suberites domuncula PE=2 SV=3 11 169 9.0E-07
sp|Q8STF0|CALM_STRIE Calmodulin OS=Strongylocentrotus intermedius PE=2 SV=3 8 169 1.0E-06
sp|P18061|CALM_TRYCR Calmodulin OS=Trypanosoma cruzi GN=CALA2 PE=3 SV=2 7 169 1.0E-06
sp|P20801|TNNC2_MOUSE Troponin C, skeletal muscle OS=Mus musculus GN=Tnnc2 PE=1 SV=2 66 169 1.0E-06
sp|A3E4D8|CALM_PROMN Calmodulin OS=Prorocentrum minimum PE=2 SV=1 11 169 1.0E-06
sp|A3E3H0|CALM_PFIPI Calmodulin OS=Pfiesteria piscicida PE=2 SV=1 11 169 1.0E-06
sp|A3E4F9|CALM_KARVE Calmodulin OS=Karlodinium veneficum PE=2 SV=1 11 169 1.0E-06
sp|A4UHC0|CALM_ALEFU Calmodulin OS=Alexandrium fundyense PE=2 SV=1 11 169 1.0E-06
sp|Q7FZF1|CNBL5_ARATH Calcineurin B-like protein 5 OS=Arabidopsis thaliana GN=CBL5 PE=1 SV=3 10 170 1.0E-06
sp|P02595|CALM_PATSP Calmodulin OS=Patinopecten sp. PE=1 SV=2 11 169 1.0E-06
sp|P21251|CALM_STIJA Calmodulin OS=Stichopus japonicus PE=1 SV=2 11 169 1.0E-06
sp|P62184|CALM_RENRE Calmodulin OS=Renilla reniformis PE=1 SV=2 11 169 1.0E-06
sp|P62155|CALM_XENLA Calmodulin OS=Xenopus laevis GN=calm1 PE=1 SV=2 11 169 1.0E-06
sp|P62151|CALM_TORCA Calmodulin OS=Torpedo californica PE=1 SV=2 11 169 1.0E-06
sp|Q6YNX6|CALM_SHEEP Calmodulin OS=Ovis aries GN=CALM2 PE=2 SV=3 11 169 1.0E-06
sp|P62161|CALM_RAT Calmodulin OS=Rattus norvegicus GN=Calm1 PE=1 SV=2 11 169 1.0E-06
sp|P62160|CALM_RABIT Calmodulin OS=Oryctolagus cuniculus GN=CALM PE=1 SV=2 11 169 1.0E-06
sp|Q5RAD2|CALM_PONAB Calmodulin OS=Pongo abelii GN=CALM PE=2 SV=3 11 169 1.0E-06
sp|Q71UH6|CALM_PERFV Calmodulin OS=Perca flavescens GN=calm PE=2 SV=3 11 169 1.0E-06
sp|P62156|CALM_ONCSP Calmodulin OS=Oncorhynchus sp. GN=calm PE=1 SV=2 11 169 1.0E-06
sp|P62204|CALM_MOUSE Calmodulin OS=Mus musculus GN=Calm1 PE=1 SV=2 11 169 1.0E-06
sp|P62158|CALM_HUMAN Calmodulin OS=Homo sapiens GN=CALM1 PE=1 SV=2 11 169 1.0E-06
sp|Q6PI52|CALM_DANRE Calmodulin OS=Danio rerio GN=calm1a PE=2 SV=3 11 169 1.0E-06
sp|Q6IT78|CALM_CTEID Calmodulin OS=Ctenopharyngodon idella GN=calm PE=2 SV=3 11 169 1.0E-06
sp|P62149|CALM_CHICK Calmodulin OS=Gallus gallus GN=CALM PE=1 SV=2 11 169 1.0E-06
sp|P62157|CALM_BOVIN Calmodulin OS=Bos taurus GN=CALM PE=1 SV=2 11 169 1.0E-06
sp|P62144|CALM_ANAPL Calmodulin OS=Anas platyrhynchos GN=CALM PE=2 SV=2 11 169 1.0E-06
sp|Q9UB37|CALM2_BRALA Calmodulin-2 OS=Branchiostoma lanceolatum GN=CAM2 PE=2 SV=3 11 171 1.0E-06
sp|P53440|CALMF_NAEGR Calmodulin, flagellar OS=Naegleria gruberi GN=CAM1 PE=2 SV=1 4 125 1.0E-06
sp|Q01583|DGK1_DROME Diacylglycerol kinase 1 OS=Drosophila melanogaster GN=Dgk PE=2 SV=5 80 172 1.0E-06
sp|Q0IQB6|CML3_ORYSJ Calmodulin-like protein 3 OS=Oryza sativa subsp. japonica GN=CML3 PE=2 SV=1 68 170 1.0E-06
sp|Q7T3T2|CALM_EPIAK Calmodulin OS=Epinephelus akaara GN=calm PE=2 SV=3 11 169 1.0E-06
sp|Q9SJN6|CML31_ARATH Probable calcium-binding protein CML31 OS=Arabidopsis thaliana GN=CML31 PE=2 SV=2 41 170 2.0E-06
sp|P62146|CALMA_ARBPU Calmodulin-alpha (Fragment) OS=Arbacia punctulata PE=1 SV=2 11 169 2.0E-06
sp|P02594|CALM_ELEEL Calmodulin OS=Electrophorus electricus GN=calm PE=2 SV=2 11 169 2.0E-06
sp|Q08AA9|NKD_ANOGA Protein naked cuticle homolog OS=Anopheles gambiae GN=nkd PE=2 SV=1 73 139 2.0E-06
sp|Q9ES45|DUOX2_RAT Dual oxidase 2 OS=Rattus norvegicus GN=Duox2 PE=2 SV=1 64 160 2.0E-06
sp|P25070|CML24_ARATH Calcium-binding protein CML24 OS=Arabidopsis thaliana GN=CML24 PE=2 SV=2 41 171 2.0E-06
sp|O02367|CALM_CIOIN Calmodulin OS=Ciona intestinalis PE=2 SV=3 11 169 2.0E-06
sp|A5A7I8|CDPK5_SOLTU Calcium-dependent protein kinase 5 OS=Solanum tuberosum GN=CPK5 PE=2 SV=1 40 189 2.0E-06
sp|Q810D1|CHP2_RAT Calcineurin B homologous protein 2 OS=Rattus norvegicus GN=Chp2 PE=1 SV=1 6 169 2.0E-06
sp|P02588|TNNC2_CHICK Troponin C, skeletal muscle OS=Gallus gallus GN=TNNC2 PE=1 SV=3 66 169 2.0E-06
sp|O16305|CALM_CAEEL Calmodulin OS=Caenorhabditis elegans GN=cmd-1 PE=1 SV=3 11 169 2.0E-06
sp|Q9XZP2|CALM2_BRAFL Calmodulin-2 OS=Branchiostoma floridae GN=CAM2 PE=2 SV=4 11 169 2.0E-06
sp|P27166|CALM_STYLE Calmodulin OS=Stylonychia lemnae PE=3 SV=2 11 169 2.0E-06
sp|Q09665|TNNC2_CAEEL Troponin C, isoform 2 OS=Caenorhabditis elegans GN=tnc-2 PE=2 SV=1 7 171 2.0E-06
sp|Q95NR9|CALM_METSE Calmodulin OS=Metridium senile PE=1 SV=3 11 169 2.0E-06
sp|P41041|CALM_PNECA Calmodulin OS=Pneumocystis carinii PE=3 SV=1 4 169 2.0E-06
sp|Q9GRJ1|CALM_LUMRU Calmodulin OS=Lumbricus rubellus PE=2 SV=3 11 169 3.0E-06
sp|P62154|CALM_LOCMI Calmodulin OS=Locusta migratoria PE=1 SV=2 11 169 3.0E-06
sp|P62152|CALM_DROME Calmodulin OS=Drosophila melanogaster GN=Cam PE=1 SV=2 11 169 3.0E-06
sp|P62145|CALM_APLCA Calmodulin OS=Aplysia californica GN=CAM PE=2 SV=2 11 169 3.0E-06
sp|P62153|CALMA_HALRO Calmodulin-A OS=Halocynthia roretzi PE=1 SV=2 11 169 3.0E-06
sp|P62148|CALM1_BRALA Calmodulin-1 OS=Branchiostoma lanceolatum PE=2 SV=2 11 169 3.0E-06
sp|P62147|CALM1_BRAFL Calmodulin-1 OS=Branchiostoma floridae PE=2 SV=2 11 169 3.0E-06
sp|Q5U206|CALL3_RAT Calmodulin-like protein 3 OS=Rattus norvegicus GN=Calml3 PE=2 SV=1 12 169 3.0E-06
sp|O96081|CALMB_HALRO Calmodulin-B OS=Halocynthia roretzi PE=3 SV=3 11 169 3.0E-06
sp|Q40302|CALM_MACPY Calmodulin OS=Macrocystis pyrifera PE=2 SV=3 11 169 3.0E-06
sp|P23286|CALM_CANAX Calmodulin OS=Candida albicans GN=CMD1 PE=3 SV=2 7 169 3.0E-06
sp|Q9ZV15|CDPKK_ARATH Calcium-dependent protein kinase 20 OS=Arabidopsis thaliana GN=CPK20 PE=3 SV=1 40 169 3.0E-06
sp|Q71UH5|CALM_PYTSP Calmodulin OS=Pythium splendens PE=2 SV=1 11 169 3.0E-06
sp|P27165|CALM_PHYIN Calmodulin OS=Phytophthora infestans GN=CMD1 PE=3 SV=2 11 169 3.0E-06
sp|P41210|CATR_ATRNU Caltractin OS=Atriplex nummularia PE=2 SV=1 68 164 3.0E-06
sp|Q9D5U0|PCT2B_MOUSE Lysophosphatidylcholine acyltransferase 2B OS=Mus musculus GN=Lpcat2b PE=2 SV=1 25 129 4.0E-06
sp|Q16HE8|NKD_AEDAE Protein naked cuticle homolog OS=Aedes aegypti GN=nkd PE=3 SV=1 84 139 4.0E-06
sp|P05933|CALM_SCHPO Calmodulin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cam1 PE=1 SV=1 7 169 4.0E-06
sp|O96102|CALM_PHYPO Calmodulin OS=Physarum polycephalum PE=2 SV=3 13 169 4.0E-06
sp|O82659|CML20_ARATH Probable calcium-binding protein CML20 OS=Arabidopsis thaliana GN=CML20 PE=1 SV=1 68 174 4.0E-06
sp|P02586|TNNC2_RABIT Troponin C, skeletal muscle OS=Oryctolagus cuniculus GN=TNNC2 PE=1 SV=2 66 169 4.0E-06
sp|P11121|CALM_PYUSP Calmodulin OS=Pyuridae sp. PE=1 SV=2 11 169 5.0E-06
sp|Q9U6D3|CALM_MYXGL Calmodulin OS=Myxine glutinosa PE=2 SV=3 11 169 5.0E-06
sp|P02597|CALMS_CHICK Calmodulin, striated muscle OS=Gallus gallus GN=CCM1 PE=3 SV=2 7 169 6.0E-06
sp|P04630|CALL_CAEEL Calmodulin-like protein OS=Caenorhabditis elegans GN=cal-1 PE=3 SV=1 68 170 6.0E-06
sp|P02587|TNNC2_PIG Troponin C, skeletal muscle OS=Sus scrofa GN=TNNC2 PE=1 SV=2 66 169 7.0E-06
sp|Q11083|YT67_CAEEL Uncharacterized calcium-binding protein B0563.7 OS=Caenorhabditis elegans GN=B0563.7 PE=3 SV=1 68 170 7.0E-06
sp|P02585|TNNC2_HUMAN Troponin C, skeletal muscle OS=Homo sapiens GN=TNNC2 PE=1 SV=2 66 169 7.0E-06
sp|A5A7I7|CDPK4_SOLTU Calcium-dependent protein kinase 4 OS=Solanum tuberosum GN=CPK4 PE=2 SV=1 27 169 7.0E-06
sp|Q9FYK2|CML25_ARATH Probable calcium-binding protein CML25 OS=Arabidopsis thaliana GN=CML25 PE=2 SV=1 34 179 8.0E-06
sp|Q91WG7|DGKG_MOUSE Diacylglycerol kinase gamma OS=Mus musculus GN=Dgkg PE=1 SV=1 57 187 8.0E-06
sp|Q95NI4|CALM_HALOK Calmodulin OS=Halichondria okadai PE=2 SV=3 8 169 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0043167 ion binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4899
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6647 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5953
Ophiocordyceps camponoti-floridani Ophcf2|03976
Ophiocordyceps camponoti-rufipedis Ophun1|1876
Ophiocordyceps kimflemingae Ophio5|1357
Ophiocordyceps subramaniannii Hirsu2|1304

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6647
MGKSQSKLSHEQLTELQKATHFDKKELQQWYKGFLKDCPSGMLTKEEFQKIYRQFFPFGDPSSFADYVFNVFDSD
KSGTIDFKEFICALSVTSRGKMEDKLDWAFQLYDIDGDGKISYDEMLQIVEAIYKMVGSMVKLPEDEDTPEKRVR
KIFRMMDKDENGSLDMDEFKEGSKRDETIVSALSLYDGLV*
Coding >OphauG2|6647
ATGGGAAAATCACAGTCCAAGCTCTCTCACGAGCAGCTTACCGAACTTCAAAAAGCCACGCATTTCGACAAGAAG
GAGCTGCAACAATGGTACAAGGGCTTTCTCAAGGACTGCCCCTCGGGAATGCTCACCAAGGAGGAATTTCAAAAA
ATATACCGCCAGTTCTTCCCCTTTGGCGACCCAAGCTCCTTTGCCGACTACGTCTTCAATGTCTTCGACAGCGAT
AAGTCGGGCACCATTGACTTTAAAGAGTTTATCTGCGCCCTCAGCGTTACGAGCCGCGGCAAGATGGAAGACAAG
CTCGACTGGGCCTTTCAGCTATACGACATTGACGGCGATGGCAAGATAAGCTACGACGAGATGCTACAGATTGTC
GAGGCCATTTACAAAATGGTGGGCTCCATGGTCAAGCTGCCAGAAGACGAGGACACGCCCGAGAAGCGGGTACGC
AAAATCTTTCGCATGATGGACAAGGACGAGAATGGGTCTTTGGACATGGATGAGTTTAAAGAGGGGAGCAAACGC
GACGAAACAATTGTCTCGGCCCTGTCGTTGTACGACGGACTTGTGTAG
Transcript >OphauG2|6647
ATGGGAAAATCACAGTCCAAGCTCTCTCACGAGCAGCTTACCGAACTTCAAAAAGCCACGCATTTCGACAAGAAG
GAGCTGCAACAATGGTACAAGGGCTTTCTCAAGGACTGCCCCTCGGGAATGCTCACCAAGGAGGAATTTCAAAAA
ATATACCGCCAGTTCTTCCCCTTTGGCGACCCAAGCTCCTTTGCCGACTACGTCTTCAATGTCTTCGACAGCGAT
AAGTCGGGCACCATTGACTTTAAAGAGTTTATCTGCGCCCTCAGCGTTACGAGCCGCGGCAAGATGGAAGACAAG
CTCGACTGGGCCTTTCAGCTATACGACATTGACGGCGATGGCAAGATAAGCTACGACGAGATGCTACAGATTGTC
GAGGCCATTTACAAAATGGTGGGCTCCATGGTCAAGCTGCCAGAAGACGAGGACACGCCCGAGAAGCGGGTACGC
AAAATCTTTCGCATGATGGACAAGGACGAGAATGGGTCTTTGGACATGGATGAGTTTAAAGAGGGGAGCAAACGC
GACGAAACAATTGTCTCGGCCCTGTCGTTGTACGACGGACTTGTGTAG
Gene >OphauG2|6647
ATGGGAAAATCGTGAGTCGCATCGTGGCTCTTGATGCTGCTGCGACGACGTCACTGTTGCGTCTTGGGGACCAGG
ATTGTCTCTTGCTGACGTTGGCTCGTCGTGTCGGCAGACAGTCCAAGCTCTCTCACGAGCAGCTTACCGAACTTC
AAAAAGCCACGCATTTCGACAAGAAGGAGCTGCAACAATGGTACAAGGGTGAGTTGACTGTGCAAGAAGAAAGAA
GCCCACCATTGTTGACCATGACAACACACAGGCTTTCTCAAGGACTGCCCCTCGGGAATGCTCACCAAGGAGGAA
TTTCAAAAAATATACCGCCAGTTCTTCCCCTTTGGCGACCCAAGCTCCTTTGCCGACTACGTCTTCAATGTCTTC
GACAGCGATAAGTCGGGCACCATTGACTTTAAAGAGTTTATCTGCGCCCTCAGCGTTACGAGCCGCGGCAAGATG
GAAGACAAGCTCGACTGGGCCTTTCAGCTATACGACATTGACGGCGATGGCAAGATAAGCTACGACGAGATGCTA
CAGATTGTCGAGGCCATTTACAAAATGGTAGCCCACACCCGGTGTGTTGCCTGTCTCGAGGCGGCGCGGAAAGCT
GACCCTTGTATATCTAGGTGGGCTCCATGGTCAAGCTGCCAGAAGACGAGGACACGCCCGAGAAGCGGGTACGCA
AAATCTTTCGCATGATGGACAAGGACGAGAATGGGTCTTTGGACATGGATGAGTTTAAAGAGGGGAGCAAACGCG
ACGAAACAATTGTCTCGGCCCTGTCGTTGTACGACGGACTTGTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail