Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6634
Gene name
LocationContig_7:54378..56864
Strand-
Gene length (bp)2486
Transcript length (bp)2283
Coding sequence length (bp)2283
Protein length (aa) 761

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00012 HSP70 Hsp70 protein 2.8E-09 339 586

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96MM6|HS12B_HUMAN Heat shock 70 kDa protein 12B OS=Homo sapiens GN=HSPA12B PE=1 SV=2 185 714 7.0E-26
sp|O43301|HS12A_HUMAN Heat shock 70 kDa protein 12A OS=Homo sapiens GN=HSPA12A PE=1 SV=2 196 707 8.0E-26
sp|Q8K0U4|HS12A_MOUSE Heat shock 70 kDa protein 12A OS=Mus musculus GN=Hspa12a PE=1 SV=1 196 707 1.0E-25
sp|B2GGP0|DNAK_KOCRD Chaperone protein DnaK OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=dnaK PE=3 SV=1 198 435 1.0E-08
sp|A6WFV7|DNAK_KINRD Chaperone protein DnaK OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=dnaK PE=3 SV=1 198 435 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96MM6|HS12B_HUMAN Heat shock 70 kDa protein 12B OS=Homo sapiens GN=HSPA12B PE=1 SV=2 185 714 7.0E-26
sp|O43301|HS12A_HUMAN Heat shock 70 kDa protein 12A OS=Homo sapiens GN=HSPA12A PE=1 SV=2 196 707 8.0E-26
sp|Q8K0U4|HS12A_MOUSE Heat shock 70 kDa protein 12A OS=Mus musculus GN=Hspa12a PE=1 SV=1 196 707 1.0E-25
sp|B2GGP0|DNAK_KOCRD Chaperone protein DnaK OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=dnaK PE=3 SV=1 198 435 1.0E-08
sp|A6WFV7|DNAK_KINRD Chaperone protein DnaK OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=dnaK PE=3 SV=1 198 435 2.0E-08
sp|Q48M01|HSCA_PSE14 Chaperone protein HscA homolog OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=hscA PE=3 SV=1 195 555 4.0E-08
sp|Q01233|HSP70_NEUCR Heat shock 70 kDa protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hsps-1 PE=2 SV=2 198 598 4.0E-08
sp|Q4ZX30|HSCA_PSEU2 Chaperone protein HscA homolog OS=Pseudomonas syringae pv. syringae (strain B728a) GN=hscA PE=3 SV=1 195 555 5.0E-08
sp|Q5B0C0|HSP7M_EMENI Heat shock 70 kDa protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN6010 PE=1 SV=1 168 596 7.0E-08
sp|P64409|DNAK_TROWT Chaperone protein DnaK OS=Tropheryma whipplei (strain Twist) GN=dnaK PE=3 SV=1 323 435 1.0E-07
sp|P64410|DNAK_TROW8 Chaperone protein DnaK OS=Tropheryma whipplei (strain TW08/27) GN=dnaK PE=3 SV=1 323 435 1.0E-07
sp|A9WQR3|DNAK_RENSM Chaperone protein DnaK OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=dnaK PE=3 SV=1 305 435 3.0E-07
sp|B8H6Q1|DNAK_ARTCA Chaperone protein DnaK OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=dnaK PE=3 SV=1 305 435 3.0E-07
sp|P10591|HSP71_YEAST Heat shock protein SSA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA1 PE=1 SV=4 198 472 4.0E-07
sp|Q6AC76|DNAK_LEIXX Chaperone protein DnaK OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=dnaK PE=3 SV=1 323 435 4.0E-07
sp|P36604|GRP78_SCHPO 78 kDa glucose-regulated protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bip1 PE=3 SV=2 177 555 4.0E-07
sp|B7ID00|DNAK_THEAB Chaperone protein DnaK OS=Thermosipho africanus (strain TCF52B) GN=dnaK PE=3 SV=1 192 455 4.0E-07
sp|Q05931|HSP7Q_YEAST Heat shock protein SSQ1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSQ1 PE=1 SV=1 197 556 5.0E-07
sp|A6LM32|DNAK_THEM4 Chaperone protein DnaK OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=dnaK PE=3 SV=1 192 455 5.0E-07
sp|A0K1L3|DNAK_ARTS2 Chaperone protein DnaK OS=Arthrobacter sp. (strain FB24) GN=dnaK PE=3 SV=1 305 454 5.0E-07
sp|C5C3P2|DNAK_BEUC1 Chaperone protein DnaK OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=dnaK PE=3 SV=1 340 467 6.0E-07
sp|Q886Z7|HSCA_PSESM Chaperone protein HscA homolog OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=hscA PE=3 SV=1 195 555 7.0E-07
sp|P40918|HSP70_DAVTA Heat shock 70 kDa protein OS=Davidiella tassiana GN=HSP70 PE=1 SV=1 305 472 7.0E-07
sp|P75344|DNAK_MYCPN Chaperone protein DnaK OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=dnaK PE=3 SV=1 196 596 7.0E-07
sp|P41826|HSP72_ANOAL Heat shock protein 70 A2 OS=Anopheles albimanus GN=HSP70A2 PE=3 SV=1 341 472 7.0E-07
sp|P41825|HSP71_ANOAL Heat shock protein 70 A1 OS=Anopheles albimanus GN=HSP70A1 PE=3 SV=1 341 472 7.0E-07
sp|Q1CV46|DNAK_HELPH Chaperone protein DnaK OS=Helicobacter pylori (strain HPAG1) GN=dnaK PE=3 SV=1 197 435 1.0E-06
sp|A5CM86|DNAK_CLAM3 Chaperone protein DnaK OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=dnaK PE=3 SV=1 341 435 1.0E-06
sp|P55994|DNAK_HELPY Chaperone protein DnaK OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=dnaK PE=3 SV=2 197 435 1.0E-06
sp|Q10284|HSP75_SCHPO Heat shock protein sks2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sks2 PE=1 SV=2 198 472 1.0E-06
sp|Q9ZMW4|DNAK_HELPJ Chaperone protein DnaK OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=dnaK PE=3 SV=3 197 435 1.0E-06
sp|B5Z9P0|DNAK_HELPG Chaperone protein DnaK OS=Helicobacter pylori (strain G27) GN=dnaK PE=3 SV=1 197 435 1.0E-06
sp|Q826F6|DNAK2_STRAW Chaperone protein dnaK2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=dnaK2 PE=3 SV=1 334 449 1.0E-06
sp|B6JPL0|DNAK_HELP2 Chaperone protein DnaK OS=Helicobacter pylori (strain P12) GN=dnaK PE=3 SV=1 197 435 1.0E-06
sp|B2URT8|DNAK_HELPS Chaperone protein DnaK OS=Helicobacter pylori (strain Shi470) GN=dnaK PE=3 SV=1 197 435 1.0E-06
sp|B8DT62|DNAK_BIFA0 Chaperone protein DnaK OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=dnaK PE=3 SV=1 323 435 1.0E-06
sp|Q00043|HSP70_AJECA Heat shock 70 kDa protein OS=Ajellomyces capsulatus GN=HSP70 PE=3 SV=1 198 606 1.0E-06
sp|B8D8V4|DNAK_BUCA5 Chaperone protein DnaK OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=dnaK PE=3 SV=1 197 455 1.0E-06
sp|O32464|DNAK_BUCAI Chaperone protein DnaK OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=dnaK PE=3 SV=1 197 455 1.0E-06
sp|B8D758|DNAK_BUCAT Chaperone protein DnaK OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=dnaK PE=3 SV=1 197 455 1.0E-06
sp|P22953|MD37E_ARATH Probable mediator of RNA polymerase II transcription subunit 37e OS=Arabidopsis thaliana GN=MED37E PE=1 SV=3 305 596 1.0E-06
sp|P08418|HSP70_SCHMA Heat shock 70 kDa protein homolog OS=Schistosoma mansoni PE=2 SV=2 198 450 2.0E-06
sp|P53421|HSP71_PICAN Heat shock protein 70 1 OS=Pichia angusta GN=HSA1 PE=1 SV=2 198 472 2.0E-06
sp|Q17VY4|DNAK_HELAH Chaperone protein DnaK OS=Helicobacter acinonychis (strain Sheeba) GN=dnaK PE=3 SV=1 197 435 2.0E-06
sp|Q1MPW1|DNAK_LAWIP Chaperone protein DnaK OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=dnaK PE=3 SV=1 197 556 2.0E-06
sp|A0QQC8|DNAK_MYCS2 Chaperone protein DnaK OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=dnaK PE=1 SV=1 198 435 2.0E-06
sp|Q97BG8|DNAK_THEVO Chaperone protein DnaK OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=dnaK PE=3 SV=1 314 602 2.0E-06
sp|Q8EUH7|DNAK_MYCPE Chaperone protein DnaK OS=Mycoplasma penetrans (strain HF-2) GN=dnaK PE=3 SV=1 194 455 2.0E-06
sp|P10592|HSP72_YEAST Heat shock protein SSA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA2 PE=1 SV=3 198 472 2.0E-06
sp|P47547|DNAK_MYCGE Chaperone protein DnaK OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=dnaK PE=3 SV=1 196 596 2.0E-06
sp|Q95YL7|HSP70_ENCHE Mitochondrial-type heat shock protein 70 OS=Encephalitozoon hellem GN=HSP70 PE=3 SV=1 180 607 2.0E-06
sp|P41827|HSP74_ANOAL Heat shock protein 70 B2 OS=Anopheles albimanus GN=HSP70B2 PE=3 SV=1 341 472 2.0E-06
sp|B0RBI1|DNAK_CLAMS Chaperone protein DnaK OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=dnaK PE=3 SV=1 341 435 2.0E-06
sp|B9DNK0|DNAK_STACT Chaperone protein DnaK OS=Staphylococcus carnosus (strain TM300) GN=dnaK PE=3 SV=1 197 606 3.0E-06
sp|Q96W30|HSP72_PARBA Heat shock 70 kDa protein 2 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=HSP70-2 PE=2 SV=2 198 606 3.0E-06
sp|Q3K7A9|HSCA_PSEPF Chaperone protein HscA homolog OS=Pseudomonas fluorescens (strain Pf0-1) GN=hscA PE=3 SV=1 195 412 3.0E-06
sp|A1A3P5|DNAK_BIFAA Chaperone protein DnaK OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=dnaK PE=3 SV=1 323 435 3.0E-06
sp|Q7NDH1|DNAK_GLOVI Chaperone protein DnaK OS=Gloeobacter violaceus (strain PCC 7421) GN=dnaK PE=3 SV=1 334 457 4.0E-06
sp|Q9W6Y1|HSP7C_ORYLA Heat shock cognate 71 kDa protein OS=Oryzias latipes GN=hsc70 PE=2 SV=1 198 472 4.0E-06
sp|P11146|HSP7B_DROME Heat shock 70 kDa protein cognate 2 OS=Drosophila melanogaster GN=Hsc70-2 PE=1 SV=2 341 472 4.0E-06
sp|A3NBA0|HSCA_BURP6 Chaperone protein HscA homolog OS=Burkholderia pseudomallei (strain 668) GN=hscA PE=3 SV=1 195 555 4.0E-06
sp|A3NX33|HSCA_BURP0 Chaperone protein HscA homolog OS=Burkholderia pseudomallei (strain 1106a) GN=hscA PE=3 SV=1 195 555 4.0E-06
sp|Q4U0F3|HS71B_BOSMU Heat shock 70 kDa protein 1B OS=Bos mutus grunniens GN=HSPA1B PE=2 SV=1 341 472 4.0E-06
sp|Q3JQN9|HSCA_BURP1 Chaperone protein HscA homolog OS=Burkholderia pseudomallei (strain 1710b) GN=hscA PE=3 SV=1 195 555 4.0E-06
sp|P50023|DNAK_THEAC Chaperone protein DnaK OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=dnaK PE=3 SV=2 314 606 4.0E-06
sp|Q63SN5|HSCA_BURPS Chaperone protein HscA homolog OS=Burkholderia pseudomallei (strain K96243) GN=hscA PE=3 SV=1 195 555 5.0E-06
sp|Q72DW8|DNAK_DESVH Chaperone protein DnaK OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=dnaK PE=3 SV=1 197 556 5.0E-06
sp|Q5B2V1|HSP70_EMENI Heat shock 70 kDa protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hsp70 PE=1 SV=1 318 606 5.0E-06
sp|Q1IWL4|DNAK_DEIGD Chaperone protein DnaK OS=Deinococcus geothermalis (strain DSM 11300) GN=dnaK PE=3 SV=1 198 455 5.0E-06
sp|A1VFG6|DNAK_DESVV Chaperone protein DnaK OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=dnaK PE=3 SV=1 197 556 5.0E-06
sp|P08108|HSP70_ONCMY Heat shock cognate 70 kDa protein OS=Oncorhynchus mykiss GN=hsc71 PE=2 SV=2 305 472 6.0E-06
sp|Q6F149|DNAK_MESFL Chaperone protein DnaK OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=dnaK PE=3 SV=1 197 555 6.0E-06
sp|P0DMW1|HS71B_RAT Heat shock 70 kDa protein 1B OS=Rattus norvegicus GN=Hspa1a PE=2 SV=1 341 472 6.0E-06
sp|P0DMW0|HS71A_RAT Heat shock 70 kDa protein 1A OS=Rattus norvegicus GN=Hspa1a PE=2 SV=1 341 472 6.0E-06
sp|A4T112|DNAK_MYCGI Chaperone protein DnaK OS=Mycobacterium gilvum (strain PYR-GCK) GN=dnaK PE=3 SV=1 198 435 6.0E-06
sp|Q01899|HSP7M_PHAVU Heat shock 70 kDa protein, mitochondrial OS=Phaseolus vulgaris PE=2 SV=1 189 602 7.0E-06
sp|A6Q421|DNAK_NITSB Chaperone protein DnaK OS=Nitratiruptor sp. (strain SB155-2) GN=dnaK PE=3 SV=1 305 435 7.0E-06
sp|Q7UM31|DNAK_RHOBA Chaperone protein DnaK OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=dnaK PE=3 SV=2 192 455 7.0E-06
sp|Q61696|HS71A_MOUSE Heat shock 70 kDa protein 1A OS=Mus musculus GN=Hspa1a PE=1 SV=2 341 472 7.0E-06
sp|P17879|HS71B_MOUSE Heat shock 70 kDa protein 1B OS=Mus musculus GN=Hspa1b PE=1 SV=3 341 472 7.0E-06
sp|A4XY39|HSCA_PSEMY Chaperone protein HscA homolog OS=Pseudomonas mendocina (strain ymp) GN=hscA PE=3 SV=1 195 436 8.0E-06
sp|B7GT47|DNAK_BIFLS Chaperone protein DnaK OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=dnaK PE=3 SV=1 323 435 8.0E-06
sp|Q7V9G2|DNAK2_PROMA Chaperone protein dnaK2 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=dnaK2 PE=3 SV=1 197 435 8.0E-06
sp|A5UAB3|HSCA_HAEIE Chaperone protein HscA homolog OS=Haemophilus influenzae (strain PittEE) GN=hscA PE=3 SV=1 195 566 8.0E-06
sp|Q8G6W1|DNAK_BIFLO Chaperone protein DnaK OS=Bifidobacterium longum (strain NCC 2705) GN=dnaK PE=3 SV=1 323 435 9.0E-06
sp|B3DNP9|DNAK_BIFLD Chaperone protein DnaK OS=Bifidobacterium longum (strain DJO10A) GN=dnaK PE=3 SV=1 323 435 9.0E-06
sp|Q9LHA8|MD37C_ARATH Probable mediator of RNA polymerase II transcription subunit 37c OS=Arabidopsis thaliana GN=MED37C PE=1 SV=1 198 596 9.0E-06
sp|P11141|HSP7F_CAEEL Heat shock 70 kDa protein F, mitochondrial OS=Caenorhabditis elegans GN=hsp-6 PE=1 SV=2 197 596 9.0E-06
sp|Q91233|HSP70_ONCTS Heat shock 70 kDa protein OS=Oncorhynchus tshawytscha GN=hsp70 PE=2 SV=1 341 555 1.0E-05
sp|Q2SXE0|HSCA_BURTA Chaperone protein HscA homolog OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=hscA PE=3 SV=1 195 555 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0140662 ATP-dependent protein folding chaperone Yes
GO:0005524 ATP binding Yes
GO:0140657 ATP-dependent activity No
GO:0044183 protein folding chaperone No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0017076 purine nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0032555 purine ribonucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6634
MSSMNSRFRGLGFGKRKSAASFQANEGVPPTSTPPPAQVGQNSRPHSQTHLGQTPPLGAASPNPSSMNQSSSGNR
PPSYSANYAQGPSGPSLDRTSSHQGRTPPSQMVGGPPPINTNAPAHYPQNMAPMSQGPPPSVSGPPPQAGPPGYV
GQTGYAGQTGYPPPPPAPPTGPIAQQFQRPNAAAEVEGSSRSKAQLIVGIDFGTTFSGVAFAFATNNEAKEDIIT
EWPGAGSYTKQKIPTVLYYDQYQKVVGWGPDIADALAPTGYPKPGVQKVEWFKLQLMLSGNTYIDPINLPPLPPG
KSEIDVAADYLFKLRQAMRSALQKTLGEVFNREERNIRYYLTVPAIWNDAGKAATRAAAIQAGFLRDENDNRLTL
ISEPEAAALFCSKTGLLNLKVHDAVLIVDCGGGTVDLIAYEVEDENPFTVAECTAGSGDSCGSTALNRNFSNILR
TKIRKMKLPDGSRTAGRVYAKCIMDFENRIKADFRNNGQKWAVDVGIEAEFPEAGIEEGYMTFTNEEILQCFEPV
VNRILELVRNQIIAIQAQSRTLQNILVVGGFGASEYLFQQIKLHVPPQFQSKVVRPMDSVAAIVKGAVTAGITER
IVTHRVARRHYLMATLQPFKDGYHPEAYRVPSLDGKDRCKFTRQIFVQKGQKVKNGEPVKVSFFRQVAPGATLMY
EDVLYACDDDVCPEYTKDPRIKEVVTLTSDLSRKNLEKDFERMETPQGTFYRVYFDIYLTLDGSEFSAELVCQGE
VMGRCRARFR*
Coding >OphauG2|6634
ATGAGTTCTATGAACTCCCGCTTTCGAGGGCTCGGGTTTGGTAAACGCAAATCAGCCGCGAGTTTCCAGGCAAAC
GAAGGAGTTCCTCCTACCAGTACGCCTCCTCCAGCCCAGGTCGGCCAAAATTCGCGCCCACACTCGCAAACACAC
CTTGGCCAGACGCCTCCCCTCGGCGCGGCCTCACCAAACCCGAGCTCCATGAACCAGTCATCGTCTGGCAATCGC
CCTCCCAGCTACTCGGCCAACTACGCTCAGGGTCCATCCGGCCCGTCACTCGACCGCACCAGCTCGCACCAAGGC
CGCACGCCCCCAAGTCAAATGGTCGGCGGACCACCCCCAATCAACACAAACGCGCCCGCACATTACCCGCAAAAC
ATGGCCCCTATGTCCCAGGGTCCTCCGCCCTCCGTTTCGGGGCCTCCGCCCCAAGCCGGCCCTCCTGGCTATGTA
GGCCAGACTGGCTATGCAGGCCAAACTGGCTACCCGCCTCCCCCTCCAGCGCCCCCCACTGGCCCTATTGCCCAG
CAGTTTCAACGTCCAAATGCGGCTGCTGAGGTTGAGGGCTCGAGTAGAAGCAAGGCCCAGCTTATTGTCGGTATC
GACTTTGGTACCACTTTTTCTGGCGTCGCTTTTGCTTTCGCGACCAACAACGAGGCCAAAGAAGACATCATCACG
GAATGGCCAGGGGCGGGCTCGTACACGAAGCAAAAAATTCCAACTGTTCTTTACTACGATCAGTACCAAAAAGTG
GTGGGCTGGGGACCCGACATAGCCGATGCCTTGGCGCCAACTGGTTATCCTAAACCTGGGGTGCAAAAGGTGGAG
TGGTTCAAGCTGCAGCTGATGCTGAGCGGAAACACCTACATCGATCCCATAAATCTGCCACCTCTTCCGCCCGGC
AAGTCTGAGATTGATGTTGCCGCAGACTATCTCTTCAAGCTGCGCCAGGCCATGCGGTCAGCGCTACAAAAGACA
CTGGGCGAAGTATTCAACCGCGAAGAGCGCAACATCCGGTACTACCTCACAGTACCCGCTATATGGAACGATGCT
GGCAAAGCAGCCACGCGGGCTGCAGCTATCCAGGCTGGCTTCTTGCGGGATGAGAATGACAATCGCCTGACTCTG
ATTTCGGAACCAGAAGCAGCGGCCTTGTTCTGTTCCAAAACGGGGCTCTTGAATCTCAAAGTGCACGATGCTGTG
CTCATTGTTGACTGTGGCGGTGGCACCGTGGATTTGATTGCATACGAGGTGGAGGATGAAAATCCTTTTACCGTT
GCCGAGTGTACGGCAGGTTCTGGTGATTCGTGTGGCTCTACGGCGCTCAACCGTAACTTTAGCAACATCTTGCGC
ACCAAGATTCGCAAGATGAAGCTTCCTGATGGGTCCCGGACAGCGGGCCGCGTCTATGCCAAGTGCATCATGGAC
TTTGAAAACAGAATCAAGGCCGACTTTCGCAACAATGGCCAGAAATGGGCGGTTGATGTGGGCATTGAAGCCGAA
TTCCCCGAAGCTGGCATCGAAGAAGGCTACATGACATTTACCAATGAGGAAATCCTGCAGTGTTTTGAACCCGTA
GTAAACCGCATTCTGGAGCTAGTGCGGAACCAGATCATCGCCATACAGGCGCAAAGTCGGACTCTGCAGAACATT
CTGGTTGTGGGTGGCTTTGGTGCATCGGAGTATCTATTCCAACAGATTAAGCTACACGTTCCACCTCAGTTTCAA
TCCAAGGTGGTGCGCCCCATGGACTCGGTGGCGGCCATTGTCAAGGGCGCGGTAACGGCTGGCATCACGGAGCGA
ATTGTTACACATCGCGTCGCACGGCGGCATTATCTCATGGCCACATTGCAGCCCTTCAAGGATGGATATCATCCC
GAGGCGTACCGAGTTCCATCGCTTGACGGCAAAGATCGGTGCAAGTTTACGCGACAGATATTTGTGCAAAAGGGC
CAAAAGGTCAAGAATGGCGAACCAGTAAAAGTATCTTTTTTCCGCCAAGTGGCGCCGGGGGCGACGCTCATGTAC
GAAGACGTCTTGTATGCATGCGACGATGACGTGTGTCCCGAATACACCAAAGACCCGCGCATCAAGGAAGTGGTA
ACGTTGACGTCGGATCTGTCACGCAAAAACCTTGAGAAGGATTTCGAGCGCATGGAGACGCCTCAAGGAACATTC
TACCGCGTCTATTTTGACATTTACCTGACTCTAGATGGGTCAGAATTCAGTGCCGAACTGGTATGCCAGGGGGAG
GTCATGGGCCGTTGCCGGGCGCGCTTCAGGTAA
Transcript >OphauG2|6634
ATGAGTTCTATGAACTCCCGCTTTCGAGGGCTCGGGTTTGGTAAACGCAAATCAGCCGCGAGTTTCCAGGCAAAC
GAAGGAGTTCCTCCTACCAGTACGCCTCCTCCAGCCCAGGTCGGCCAAAATTCGCGCCCACACTCGCAAACACAC
CTTGGCCAGACGCCTCCCCTCGGCGCGGCCTCACCAAACCCGAGCTCCATGAACCAGTCATCGTCTGGCAATCGC
CCTCCCAGCTACTCGGCCAACTACGCTCAGGGTCCATCCGGCCCGTCACTCGACCGCACCAGCTCGCACCAAGGC
CGCACGCCCCCAAGTCAAATGGTCGGCGGACCACCCCCAATCAACACAAACGCGCCCGCACATTACCCGCAAAAC
ATGGCCCCTATGTCCCAGGGTCCTCCGCCCTCCGTTTCGGGGCCTCCGCCCCAAGCCGGCCCTCCTGGCTATGTA
GGCCAGACTGGCTATGCAGGCCAAACTGGCTACCCGCCTCCCCCTCCAGCGCCCCCCACTGGCCCTATTGCCCAG
CAGTTTCAACGTCCAAATGCGGCTGCTGAGGTTGAGGGCTCGAGTAGAAGCAAGGCCCAGCTTATTGTCGGTATC
GACTTTGGTACCACTTTTTCTGGCGTCGCTTTTGCTTTCGCGACCAACAACGAGGCCAAAGAAGACATCATCACG
GAATGGCCAGGGGCGGGCTCGTACACGAAGCAAAAAATTCCAACTGTTCTTTACTACGATCAGTACCAAAAAGTG
GTGGGCTGGGGACCCGACATAGCCGATGCCTTGGCGCCAACTGGTTATCCTAAACCTGGGGTGCAAAAGGTGGAG
TGGTTCAAGCTGCAGCTGATGCTGAGCGGAAACACCTACATCGATCCCATAAATCTGCCACCTCTTCCGCCCGGC
AAGTCTGAGATTGATGTTGCCGCAGACTATCTCTTCAAGCTGCGCCAGGCCATGCGGTCAGCGCTACAAAAGACA
CTGGGCGAAGTATTCAACCGCGAAGAGCGCAACATCCGGTACTACCTCACAGTACCCGCTATATGGAACGATGCT
GGCAAAGCAGCCACGCGGGCTGCAGCTATCCAGGCTGGCTTCTTGCGGGATGAGAATGACAATCGCCTGACTCTG
ATTTCGGAACCAGAAGCAGCGGCCTTGTTCTGTTCCAAAACGGGGCTCTTGAATCTCAAAGTGCACGATGCTGTG
CTCATTGTTGACTGTGGCGGTGGCACCGTGGATTTGATTGCATACGAGGTGGAGGATGAAAATCCTTTTACCGTT
GCCGAGTGTACGGCAGGTTCTGGTGATTCGTGTGGCTCTACGGCGCTCAACCGTAACTTTAGCAACATCTTGCGC
ACCAAGATTCGCAAGATGAAGCTTCCTGATGGGTCCCGGACAGCGGGCCGCGTCTATGCCAAGTGCATCATGGAC
TTTGAAAACAGAATCAAGGCCGACTTTCGCAACAATGGCCAGAAATGGGCGGTTGATGTGGGCATTGAAGCCGAA
TTCCCCGAAGCTGGCATCGAAGAAGGCTACATGACATTTACCAATGAGGAAATCCTGCAGTGTTTTGAACCCGTA
GTAAACCGCATTCTGGAGCTAGTGCGGAACCAGATCATCGCCATACAGGCGCAAAGTCGGACTCTGCAGAACATT
CTGGTTGTGGGTGGCTTTGGTGCATCGGAGTATCTATTCCAACAGATTAAGCTACACGTTCCACCTCAGTTTCAA
TCCAAGGTGGTGCGCCCCATGGACTCGGTGGCGGCCATTGTCAAGGGCGCGGTAACGGCTGGCATCACGGAGCGA
ATTGTTACACATCGCGTCGCACGGCGGCATTATCTCATGGCCACATTGCAGCCCTTCAAGGATGGATATCATCCC
GAGGCGTACCGAGTTCCATCGCTTGACGGCAAAGATCGGTGCAAGTTTACGCGACAGATATTTGTGCAAAAGGGC
CAAAAGGTCAAGAATGGCGAACCAGTAAAAGTATCTTTTTTCCGCCAAGTGGCGCCGGGGGCGACGCTCATGTAC
GAAGACGTCTTGTATGCATGCGACGATGACGTGTGTCCCGAATACACCAAAGACCCGCGCATCAAGGAAGTGGTA
ACGTTGACGTCGGATCTGTCACGCAAAAACCTTGAGAAGGATTTCGAGCGCATGGAGACGCCTCAAGGAACATTC
TACCGCGTCTATTTTGACATTTACCTGACTCTAGATGGGTCAGAATTCAGTGCCGAACTGGTATGCCAGGGGGAG
GTCATGGGCCGTTGCCGGGCGCGCTTCAGGTAA
Gene >OphauG2|6634
ATGAGTTCTATGAACTCCCGCTTTCGAGGGCTCGGGTTTGGTAAACGCAAATCAGCCGCGAGTTTCCAGGCAAAC
GAAGGAGTTCCTCCTACCAGTACGCCTCCTCCAGCCCAGGTCGGCCAAAATTCGCGCCCACACTCGCAAACACAC
CTTGGCCAGACGCCTCCCCTCGGCGCGGCCTCACCAAACCCGAGCTCCATGAACCAGTCATCGTCTGGCAATCGC
CCTCCCAGCTACTCGGCCAACTACGCTCAGGGTCCATCCGGCCCGTCACTCGACCGCACCAGCTCGCACCAAGGC
CGCACGCCCCCAAGTCAAATGGTCGGCGGACCACCCCCAATCAACACAAACGCGCCCGCACATTACCCGCAAAAC
ATGGCCCCTATGTCCCAGGGTCCTCCGCCCTCCGTTTCGGGGCCTCCGCCCCAAGCCGGCCCTCCTGGCTATGTA
GGCCAGACTGGCTATGCAGGCCAAACTGGCTACCCGCCTCCCCCTCCAGCGCCCCCCACTGGCCCTATTGCCCAG
CAGTTTCAACGTCCAAATGCGGCTGCTGAGGTTGAGGGCTCGAGTAGAAGCAAGGCCCAGCTTATTGTCGGTATC
GACTTTGTGAGTAGATGGGCATTTTCAGCCTGGTATTGACTGCTTCGCGTTCAATGGCTAATCCTGCCGGCAGGG
TACCACTTTTTCTGGCGTCGCTTTTGCTTTCGCGACCAACAACGAGGCCAAAGAAGACATCATCACGGAATGGCC
AGGGGCGGGCTCGTACACGAAGCAAAAAGTCAGCAAAGGCCCATTTAGTCCGAGCCGTGTACCTGTGCGATACTG
ACACAATGGCAACAGATTCCAACTGTTCTTTACTACGATCAGTACCAAAAAGTGGTGGGCTGGGGACCCGACATA
GCCGATGCCTTGGCGCCAACTGGTTATCCTAAACCTGGGGTGCAAAAGGTGGAGTGGTTCAAGCTGCAGCTGATG
CTGAGCGGAAACACCTACATCGATCCCATAAATCTGCCACCTCTTCCGCCCGGCAAGTCTGAGATTGATGTTGCC
GCAGACTATCTCTTCAAGCTGCGCCAGGCCATGCGGTCAGCGCTACAAAAGACACTGGGCGAAGTATTCAACCGC
GAAGAGCGCAACATCCGGTACTACCTCACAGTACCCGCTATATGGAACGATGCTGGCAAAGCAGCCACGCGGGCT
GCAGCTATCCAGGCTGGCTTCTTGCGGGATGAGAATGACAATCGCCTGACTCTGATTTCGGAACCAGAAGCAGCG
GCCTTGTTCTGTTCCAAAACGGGGCTCTTGAATCTCAAAGTGCACGATGCTGTGCTCATTGTTGACTGTGGCGGT
GGCACCGTGGATTTGATTGCATACGAGGTGGAGGATGAAAATCCTTTTACCGTTGCCGAGTGTACGGCAGGTTCT
GGTGATTCGTGTGGCTCTACGGCGCTCAACCGTAACTTTAGCAACATCTTGCGCACCAAGATTCGCAAGATGAAG
CTTCCTGATGGGTCCCGGACAGCGGGCCGCGTCTATGCCAAGTGCATCATGGACTTTGAAAACAGAATCAAGGCC
GACTTTCGCAACAATGGCCAGAAATGGGCGGTTGATGTGGGCATTGAAGCCGAATTCCCCGAAGCTGGCATCGAA
GAAGGCTACATGACATTTACCAATGAGGAAATCCTGCAGTGTTTTGAACCCGTAGTAAACCGCATTCTGGAGCTA
GTGCGGAACCAGATCATCGCCATACAGGCGCAAAGTCGGACTCTGCAGAACATTCTGGTTGTGGGTGGCTTTGGT
GCATCGGAGTATCTATTCCAACAGATTAAGCTACACGTTCCACCTCAGTTTCAATCCAAGGTGGTGCGCCCCATG
GACTCGGTGGCGGCCATTGTCAAGGGCGCGGTAACGGCTGGCATCACGGAGCGAATTGTTACACATCGCGTCGCA
CGGCGGCATTATCTCATGGCCACATTGCAGCCCTTCAAGGATGGATATCATCCCGAGGCGTACCGAGTTCCATCG
CTTGACGGCAAAGATCGGTGCAAGTTTACGCGACAGATATTTGTGCAAAAGGGCCAAAAGGTCAAGAATGGCGAA
CCAGTAAAAGTATCTTTTTTCCGCCAAGTGGCGCCGGGGGCGACGCTCATGTACGAAGACGTCTTGTATGCATGC
GACGATGACGTGTGTCCCGAATACACCAAAGACCCGCGTGAGTTGCAGCCCGGTCGTGGTCGGCCTCTCTGTCTG
TCTGACTGGTGCGGTATGCTAATTGAGTCGGGTTAGGCATCAAGGAAGTGGTAACGTTGACGTCGGATCTGTCAC
GCAAAAACCTTGAGAAGGATTTCGAGCGCATGGAGACGCCTCAAGGAACATTCTACCGCGTCTATTTTGACATTT
ACCTGACTCTAGATGGGTCAGAATTCAGTGCCGAACTGGTATGCCAGGGGGAGGTCATGGGCCGTTGCCGGGCGC
GCTTCAGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail