Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6626
Gene name
LocationContig_7:39350..40442
Strand-
Gene length (bp)1092
Transcript length (bp)972
Coding sequence length (bp)972
Protein length (aa) 324

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 1.7E-14 30 270
PF12146 Hydrolase_4 Serine aminopeptidase, S33 3.6E-14 57 268
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 1.6E-13 36 271

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P19076|DMPD_PSEUF 2-hydroxymuconate semialdehyde hydrolase OS=Pseudomonas sp. (strain CF600) GN=dmpD PE=3 SV=1 28 286 6.0E-10
sp|A1JSF8|BIOH_YERE8 Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=bioH PE=3 SV=1 31 286 2.0E-09
sp|B1JHZ5|BIOH_YERPY Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=bioH PE=3 SV=1 31 287 2.0E-09
sp|A9R4D0|BIOH_YERPG Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=bioH PE=3 SV=1 31 287 2.0E-09
sp|Q74Y45|BIOH_YERPE Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Yersinia pestis GN=bioH PE=3 SV=2 31 287 2.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P19076|DMPD_PSEUF 2-hydroxymuconate semialdehyde hydrolase OS=Pseudomonas sp. (strain CF600) GN=dmpD PE=3 SV=1 28 286 6.0E-10
sp|A1JSF8|BIOH_YERE8 Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=bioH PE=3 SV=1 31 286 2.0E-09
sp|B1JHZ5|BIOH_YERPY Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=bioH PE=3 SV=1 31 287 2.0E-09
sp|A9R4D0|BIOH_YERPG Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=bioH PE=3 SV=1 31 287 2.0E-09
sp|Q74Y45|BIOH_YERPE Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Yersinia pestis GN=bioH PE=3 SV=2 31 287 2.0E-09
sp|A7FNV8|BIOH_YERP3 Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=bioH PE=3 SV=1 31 287 2.0E-09
sp|Q664J8|BIOH_YERPS Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=bioH PE=3 SV=1 31 287 7.0E-09
sp|B2K5V7|BIOH_YERPB Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=bioH PE=3 SV=1 31 287 7.0E-09
sp|B5XTS4|BIOH_KLEP3 Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Klebsiella pneumoniae (strain 342) GN=bioH PE=3 SV=1 31 276 7.0E-09
sp|A6TF35|BIOH_KLEP7 Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=bioH PE=3 SV=1 31 274 8.0E-09
sp|A0KF11|BIOH_AERHH Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=bioH PE=3 SV=1 27 282 1.0E-08
sp|P0A573|Y2734_MYCBO Uncharacterized protein Mb2734 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2734 PE=3 SV=1 15 291 2.0E-08
sp|P9WNH3|Y2715_MYCTU Uncharacterized protein Rv2715 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2715 PE=1 SV=1 15 291 2.0E-08
sp|P9WNH2|Y2715_MYCTO Uncharacterized protein MT2788 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2788 PE=3 SV=1 15 291 2.0E-08
sp|P23133|TODF_PSEP1 2-hydroxy-6-oxo-2,4-heptadienoate hydrolase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=todF PE=3 SV=2 28 286 2.0E-08
sp|P47229|BPHD_BURXL 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase OS=Burkholderia xenovorans (strain LB400) GN=bphD PE=1 SV=1 58 282 3.0E-08
sp|B7M2Z7|MHPC_ECO8A 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli O8 (strain IAI1) GN=mhpC PE=3 SV=2 58 282 7.0E-08
sp|A7ZI96|MHPC_ECO24 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mhpC PE=3 SV=2 58 282 7.0E-08
sp|B7L505|MHPC_ECO55 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli (strain 55989 / EAEC) GN=mhpC PE=3 SV=2 58 282 7.0E-08
sp|B7NK06|MHPC_ECO7I 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mhpC PE=3 SV=2 58 282 7.0E-08
sp|A7ZWZ6|MHPC_ECOHS 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli O9:H4 (strain HS) GN=mhpC PE=3 SV=2 58 282 7.0E-08
sp|B7N8Q6|MHPC_ECOLU 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mhpC PE=3 SV=2 58 282 7.0E-08
sp|B6HZX5|MHPC_ECOSE 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli (strain SE11) GN=mhpC PE=3 SV=2 58 282 7.0E-08
sp|Q8X5K0|MHPC_ECO57 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli O157:H7 GN=mhpC PE=3 SV=3 58 282 8.0E-08
sp|A1VUV0|BPHD_POLNA 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase OS=Polaromonas naphthalenivorans (strain CJ2) GN=bphD PE=3 SV=1 58 282 9.0E-08
sp|B7MPB6|MHPC_ECO81 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli O81 (strain ED1a) GN=mhpC PE=3 SV=2 58 282 9.0E-08
sp|B7NMH7|BIOH_ECO7I Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=bioH PE=3 SV=1 25 278 1.0E-07
sp|A8IAD8|RUTD_AZOC5 Putative aminoacrylate hydrolase RutD OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rutD PE=3 SV=1 28 245 2.0E-07
sp|A8GKT5|BIOH_SERP5 Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Serratia proteamaculans (strain 568) GN=bioH PE=3 SV=1 31 285 2.0E-07
sp|B7UKB7|BIOH_ECO27 Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=bioH PE=3 SV=1 25 278 3.0E-07
sp|Q03NE0|PIP_LACBA Proline iminopeptidase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=pip PE=3 SV=1 8 290 3.0E-07
sp|B1LHL2|BIOH_ECOSM Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=bioH PE=3 SV=1 25 278 3.0E-07
sp|B1M5I5|RUTD_METRJ Putative aminoacrylate hydrolase RutD OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rutD PE=3 SV=1 24 285 3.0E-07
sp|Q890D8|PIP_LACPL Proline iminopeptidase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=pip PE=3 SV=2 14 286 4.0E-07
sp|B7NE17|BIOH_ECOLU Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=bioH PE=3 SV=1 25 278 4.0E-07
sp|B9JLT6|RUTD_AGRRK Putative aminoacrylate hydrolase RutD OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=rutD PE=3 SV=1 44 259 4.0E-07
sp|Q52011|BPHD_PSEPS 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase OS=Pseudomonas pseudoalcaligenes GN=bphD PE=2 SV=1 58 282 4.0E-07
sp|Q6DRD9|ABHDB_DANRE Alpha/beta hydrolase domain-containing protein 11 OS=Danio rerio GN=abhd11 PE=2 SV=1 6 131 5.0E-07
sp|Q8KZP5|MHPC_COMTE 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Comamonas testosteroni GN=mhpC PE=1 SV=1 58 282 5.0E-07
sp|P77044|MHPC_ECOLI 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli (strain K12) GN=mhpC PE=1 SV=4 58 282 5.0E-07
sp|B1XBJ6|MHPC_ECODH 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli (strain K12 / DH10B) GN=mhpC PE=3 SV=2 58 282 5.0E-07
sp|P17548|BPHD_PSES1 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase OS=Pseudomonas sp. (strain KKS102) GN=bphD PE=1 SV=2 58 282 5.0E-07
sp|C4LA13|BIOH_TOLAT Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=bioH PE=3 SV=1 22 290 6.0E-07
sp|B6I2X6|BIOH_ECOSE Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Escherichia coli (strain SE11) GN=bioH PE=3 SV=1 25 278 6.0E-07
sp|B1IP53|BIOH_ECOLC Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=bioH PE=3 SV=1 25 278 6.0E-07
sp|A8A5M0|BIOH_ECOHS Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Escherichia coli O9:H4 (strain HS) GN=bioH PE=3 SV=1 25 278 6.0E-07
sp|B7M1W8|BIOH_ECO8A Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Escherichia coli O8 (strain IAI1) GN=bioH PE=3 SV=1 25 278 6.0E-07
sp|P13001|BIOH_ECOLI Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Escherichia coli (strain K12) GN=bioH PE=1 SV=1 25 278 7.0E-07
sp|B1X758|BIOH_ECODH Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Escherichia coli (strain K12 / DH10B) GN=bioH PE=3 SV=1 25 278 7.0E-07
sp|C4ZUR7|BIOH_ECOBW Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=bioH PE=3 SV=1 25 278 7.0E-07
sp|Q83PW0|BIOH_SHIFL Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Shigella flexneri GN=bioH PE=1 SV=4 25 278 8.0E-07
sp|Q2VLB9|BPHD_BURCE 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase OS=Burkholderia cepacia GN=bphD PE=3 SV=1 52 282 8.0E-07
sp|A6TAC7|MHPC_KLEP7 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mhpC PE=3 SV=1 58 282 9.0E-07
sp|Q87TC2|BIOH_VIBPA Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=bioH PE=3 SV=2 16 270 1.0E-06
sp|A7ZSU1|BIOH_ECO24 Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=bioH PE=3 SV=1 25 278 1.0E-06
sp|Q8GHL1|BIOH_SERMA Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Serratia marcescens GN=bioH PE=1 SV=1 31 282 1.0E-06
sp|Q59695|ACOC_PSEPU Dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system OS=Pseudomonas putida GN=acoC PE=3 SV=1 11 128 1.0E-06
sp|B7LSB5|BIOH_ESCF3 Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=bioH PE=3 SV=1 25 278 2.0E-06
sp|B7L4T9|BIOH_ECO55 Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Escherichia coli (strain 55989 / EAEC) GN=bioH PE=3 SV=1 25 278 2.0E-06
sp|P9WNH5|HSAD_MYCTU 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=hsaD PE=1 SV=1 49 282 2.0E-06
sp|P9WNH4|HSAD_MYCTO 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=hsaD PE=3 SV=1 49 282 2.0E-06
sp|A8AQW5|BIOH_CITK8 Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=bioH PE=3 SV=1 31 245 3.0E-06
sp|Q2NQH6|BIOH_SODGM Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Sodalis glossinidius (strain morsitans) GN=bioH PE=3 SV=1 31 281 3.0E-06
sp|B7N145|BIOH_ECO81 Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Escherichia coli O81 (strain ED1a) GN=bioH PE=3 SV=1 60 278 4.0E-06
sp|B5F8M6|BIOH_SALA4 Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Salmonella agona (strain SL483) GN=bioH PE=3 SV=1 31 276 5.0E-06
sp|Q8FCT4|BIOH_ECOL6 Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=bioH PE=3 SV=1 25 278 5.0E-06
sp|B5BHG7|BIOH_SALPK Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Salmonella paratyphi A (strain AKU_12601) GN=bioH PE=3 SV=1 31 276 6.0E-06
sp|Q31VM0|BIOH_SHIBS Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Shigella boydii serotype 4 (strain Sb227) GN=bioH PE=3 SV=1 25 278 6.0E-06
sp|C7CM33|RUTD_METED Putative aminoacrylate hydrolase RutD OS=Methylobacterium extorquens (strain DSM 5838 / DM4) GN=rutD PE=3 SV=1 24 282 6.0E-06
sp|Q57IW5|BIOH_SALCH Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Salmonella choleraesuis (strain SC-B67) GN=bioH PE=3 SV=1 31 276 6.0E-06
sp|B5R369|BIOH_SALEP Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Salmonella enteritidis PT4 (strain P125109) GN=bioH PE=3 SV=1 31 276 6.0E-06
sp|B5R7K5|BIOH_SALG2 Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=bioH PE=3 SV=1 31 276 6.0E-06
sp|Q5PLY8|BIOH_SALPA Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=bioH PE=3 SV=1 31 276 6.0E-06
sp|C0Q0I5|BIOH_SALPC Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Salmonella paratyphi C (strain RKS4594) GN=bioH PE=3 SV=1 31 276 6.0E-06
sp|Q8Z221|BIOH_SALTI Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Salmonella typhi GN=bioH PE=3 SV=1 31 276 6.0E-06
sp|B5FJT1|BIOH_SALDC Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Salmonella dublin (strain CT_02021853) GN=bioH PE=3 SV=1 31 276 6.0E-06
sp|B4TKT6|BIOH_SALHS Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Salmonella heidelberg (strain SL476) GN=bioH PE=3 SV=1 31 276 6.0E-06
sp|Q8ZLI9|BIOH_SALTY Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=bioH PE=1 SV=1 31 276 6.0E-06
sp|B2U3M2|BIOH_SHIB3 Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=bioH PE=3 SV=1 25 278 6.0E-06
sp|Q3YWL3|BIOH_SHISS Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Shigella sonnei (strain Ss046) GN=bioH PE=3 SV=1 25 278 6.0E-06
sp|A8GCT3|RUTD_SERP5 Putative aminoacrylate hydrolase RutD OS=Serratia proteamaculans (strain 568) GN=rutD PE=3 SV=1 31 131 9.0E-06
sp|C5BGT3|BIOH_EDWI9 Pimeloyl-[acyl-carrier protein] methyl ester esterase OS=Edwardsiella ictaluri (strain 93-146) GN=bioH PE=3 SV=1 31 283 9.0E-06
sp|B1ZB18|RUTD_METPB Putative aminoacrylate hydrolase RutD OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rutD PE=3 SV=1 31 282 1.0E-05
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6093
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6626 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3091
Ophiocordyceps subramaniannii Hirsu2|3247

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6626
MAGEYGHDEWAEAGGTRFAYRRLGRAQGIPLMLLMGFRGTMDDWDPALVKALAATRPVLLVDNPGAGRSAGHVPQ
SIAAWAQQCSELLHVLELGPVDVLGFSMGGCVAQMMALNTPQMVRRLVLCGTTPSMGPGVMAAPMEPFGQLSAAV
SDEERREAYLATFFTSSERSQAAGRASWHRIASAAMAHQTPPDKARRQAVAFAKFMDRRQASQASFDRLHELRLP
VLVASGSHDVLLPTQNTIVLWSKLTHAQAHLHLFPDSGHGFLFQHARCFARLVNHFLDDDDDDDDDDDDDDDDDG
DGDDGSNDDDGSNGSNGKRHCRL*
Coding >OphauG2|6626
ATGGCAGGGGAATACGGGCACGACGAATGGGCCGAGGCGGGCGGGACGCGGTTTGCCTACCGCCGGCTGGGGCGG
GCTCAGGGAATTCCACTCATGCTGCTCATGGGCTTCAGAGGCACCATGGACGACTGGGATCCAGCCCTGGTCAAG
GCTCTCGCTGCAACGCGCCCTGTGCTGCTGGTGGACAATCCCGGGGCGGGCCGGTCCGCGGGCCATGTGCCCCAG
AGCATTGCCGCCTGGGCCCAGCAGTGCAGCGAGCTGCTCCATGTGCTGGAGCTGGGCCCAGTCGACGTCTTGGGC
TTCTCCATGGGCGGGTGCGTGGCGCAGATGATGGCGCTCAACACGCCGCAGATGGTGCGGCGGCTGGTGCTGTGC
GGCACGACGCCCAGCATGGGCCCAGGCGTCATGGCGGCTCCCATGGAGCCCTTTGGCCAGCTGAGTGCTGCCGTG
AGCGACGAGGAGCGGCGCGAAGCCTATCTGGCCACCTTTTTCACCTCTTCGGAGCGCAGCCAGGCGGCAGGTCGT
GCGTCGTGGCACCGCATCGCCAGCGCCGCCATGGCCCATCAGACGCCACCGGACAAGGCGCGCCGGCAAGCCGTT
GCATTTGCCAAGTTTATGGACCGCCGGCAGGCTAGCCAGGCCTCGTTTGACCGCCTGCACGAGCTGAGGCTGCCC
GTGCTTGTTGCAAGTGGCAGCCATGACGTGCTGCTGCCGACGCAAAACACCATTGTGTTGTGGAGCAAGCTCACG
CATGCCCAGGCCCATCTGCACCTGTTTCCCGACTCGGGCCACGGCTTTCTGTTCCAGCACGCGCGTTGCTTTGCC
CGCCTCGTCAACCACTTTCTCGACGACGACGACGACGACGACGACGACGACGACGACGACGACGACGACGACGGC
GACGGCGACGACGGCAGCAACGACGACGACGGCAGCAACGGCAGCAACGGCAAAAGACACTGCCGTCTGTAG
Transcript >OphauG2|6626
ATGGCAGGGGAATACGGGCACGACGAATGGGCCGAGGCGGGCGGGACGCGGTTTGCCTACCGCCGGCTGGGGCGG
GCTCAGGGAATTCCACTCATGCTGCTCATGGGCTTCAGAGGCACCATGGACGACTGGGATCCAGCCCTGGTCAAG
GCTCTCGCTGCAACGCGCCCTGTGCTGCTGGTGGACAATCCCGGGGCGGGCCGGTCCGCGGGCCATGTGCCCCAG
AGCATTGCCGCCTGGGCCCAGCAGTGCAGCGAGCTGCTCCATGTGCTGGAGCTGGGCCCAGTCGACGTCTTGGGC
TTCTCCATGGGCGGGTGCGTGGCGCAGATGATGGCGCTCAACACGCCGCAGATGGTGCGGCGGCTGGTGCTGTGC
GGCACGACGCCCAGCATGGGCCCAGGCGTCATGGCGGCTCCCATGGAGCCCTTTGGCCAGCTGAGTGCTGCCGTG
AGCGACGAGGAGCGGCGCGAAGCCTATCTGGCCACCTTTTTCACCTCTTCGGAGCGCAGCCAGGCGGCAGGTCGT
GCGTCGTGGCACCGCATCGCCAGCGCCGCCATGGCCCATCAGACGCCACCGGACAAGGCGCGCCGGCAAGCCGTT
GCATTTGCCAAGTTTATGGACCGCCGGCAGGCTAGCCAGGCCTCGTTTGACCGCCTGCACGAGCTGAGGCTGCCC
GTGCTTGTTGCAAGTGGCAGCCATGACGTGCTGCTGCCGACGCAAAACACCATTGTGTTGTGGAGCAAGCTCACG
CATGCCCAGGCCCATCTGCACCTGTTTCCCGACTCGGGCCACGGCTTTCTGTTCCAGCACGCGCGTTGCTTTGCC
CGCCTCGTCAACCACTTTCTCGACGACGACGACGACGACGACGACGACGACGACGACGACGACGACGACGACGGC
GACGGCGACGACGGCAGCAACGACGACGACGGCAGCAACGGCAGCAACGGCAAAAGACACTGCCGTCTGTAG
Gene >OphauG2|6626
ATGGCAGGGGAATACGGGCACGACGAATGGGCCGAGGCGGGCGGGACGCGGTTTGCCTACCGCCGGCTGGGGCGG
GCTCAGGGAATTCCACTCATGCTGCTCATGGGCTTCAGGTAGGGATACATGTCGATTGCATGCATGCGTGGCTGA
CCATGGCCCTCCCGGCAGAGGCACCATGGACGACTGGGATCCAGCCCTGGTCAAGGCTCTCGCTGCAACGCGCCC
TGTGCTGCTGGTGGACAATCCCGGGGCGGGCCGGTCCGCGGGCCATGTGCCCCAGAGCATTGCCGCCTGGGCCCA
GCAGTGCAGCGAGCTGCTCCATGTGCTGGAGCTGGGCCCAGTCGACGTCTTGGGCTTCTCCATGGGCGGGTGCGT
GGCGCAGATGATGGCGCTCAACACGCCGCAGATGGTGCGGCGGCTGGTGCTGTGCGGCACGACGCCCAGCATGGG
CCCAGGCGTCATGGCGGCTCCCATGGAGCCCTTTGGCCAGCTGAGTGCTGCCGTGAGCGACGAGGAGCGGCGCGA
AGCCTATCTGGCCACCTTTTTCACCTCTTCGGAGCGCAGCCAGGCGGCAGGTCGTGCGTCGTGGCACCGCATCGC
CAGCGCCGCCATGGCCCATCAGACGCCACCGGACAAGGCGCGCCGGCAAGCCGTTGCATTTGCCAAGTTTATGGA
CCGCCGGCAGGCTAGCCAGGCCTCGTTTGACCGCCTGCACGAGCTGAGGCTGCCCGTGCTTGTTGCAAGTGGTAT
GCTGCGGCGCTTGTCTTGGCACACATGACTGTCGACGCTGCTGACCGACTGGAAAAACCAGGCAGCCATGACGTG
CTGCTGCCGACGCAAAACACCATTGTGTTGTGGAGCAAGCTCACGCATGCCCAGGCCCATCTGCACCTGTTTCCC
GACTCGGGCCACGGCTTTCTGTTCCAGCACGCGCGTTGCTTTGCCCGCCTCGTCAACCACTTTCTCGACGACGAC
GACGACGACGACGACGACGACGACGACGACGACGACGACGACGGCGACGGCGACGACGGCAGCAACGACGACGAC
GGCAGCAACGGCAGCAACGGCAAAAGACACTGCCGTCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail