Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6621
Gene name
LocationContig_7:27599..28325
Strand+
Gene length (bp)726
Transcript length (bp)612
Coding sequence length (bp)612
Protein length (aa) 204

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01849 NAC NAC domain 6.3E-22 51 106
PF19026 HYPK_UBA HYPK UBA domain 2.7E-09 165 201

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I2J8|NACA_GIBZE Nascent polypeptide-associated complex subunit alpha OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=EGD2 PE=3 SV=1 1 203 5.0E-89
sp|Q2H4Z2|NACA_CHAGB Nascent polypeptide-associated complex subunit alpha OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=EGD2 PE=3 SV=2 1 203 3.0E-81
sp|Q7SI17|NACA_NEUCR Nascent polypeptide-associated complex subunit alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=npc-1 PE=3 SV=1 1 203 8.0E-81
sp|A4RC89|NACA_MAGO7 Nascent polypeptide-associated complex subunit alpha OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=EGD2 PE=3 SV=1 1 203 4.0E-78
sp|A7EIZ1|NACA_SCLS1 Nascent polypeptide-associated complex subunit alpha OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=egd2 PE=3 SV=1 1 203 7.0E-72
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I2J8|NACA_GIBZE Nascent polypeptide-associated complex subunit alpha OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=EGD2 PE=3 SV=1 1 203 5.0E-89
sp|Q2H4Z2|NACA_CHAGB Nascent polypeptide-associated complex subunit alpha OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=EGD2 PE=3 SV=2 1 203 3.0E-81
sp|Q7SI17|NACA_NEUCR Nascent polypeptide-associated complex subunit alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=npc-1 PE=3 SV=1 1 203 8.0E-81
sp|A4RC89|NACA_MAGO7 Nascent polypeptide-associated complex subunit alpha OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=EGD2 PE=3 SV=1 1 203 4.0E-78
sp|A7EIZ1|NACA_SCLS1 Nascent polypeptide-associated complex subunit alpha OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=egd2 PE=3 SV=1 1 203 7.0E-72
sp|A6R641|NACA_AJECN Nascent polypeptide-associated complex subunit alpha OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=EGD2 PE=3 SV=2 1 203 7.0E-69
sp|Q1DHR3|NACA_COCIM Nascent polypeptide-associated complex subunit alpha OS=Coccidioides immitis (strain RS) GN=EGD2 PE=3 SV=1 1 203 5.0E-66
sp|A6SB28|NACA_BOTFB Nascent polypeptide-associated complex subunit alpha OS=Botryotinia fuckeliana (strain B05.10) GN=egd2 PE=3 SV=1 1 203 3.0E-64
sp|P0C2C7|NACA_ASPTN Nascent polypeptide-associated complex subunit alpha OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=egd2 PE=3 SV=1 1 203 8.0E-64
sp|Q5AYK0|NACA_EMENI Nascent polypeptide-associated complex subunit alpha OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=egd2 PE=3 SV=1 1 203 4.0E-63
sp|A2R4V1|NACA_ASPNC Nascent polypeptide-associated complex subunit alpha OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=egd2 PE=3 SV=1 1 203 2.0E-62
sp|Q2U955|NACA_ASPOR Nascent polypeptide-associated complex subunit alpha OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=egd2 PE=3 SV=1 1 203 2.0E-62
sp|A1DLM0|NACA_NEOFI Nascent polypeptide-associated complex subunit alpha OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=egd2 PE=3 SV=1 1 203 2.0E-57
sp|Q4WD81|NACA_ASPFU Nascent polypeptide-associated complex subunit alpha OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=egd2 PE=3 SV=1 1 203 2.0E-57
sp|A1CMF8|NACA_ASPCL Nascent polypeptide-associated complex subunit alpha OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=egd2 PE=3 SV=1 1 203 5.0E-57
sp|Q0UKB5|NACA_PHANO Nascent polypeptide-associated complex subunit alpha OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=EGD2 PE=3 SV=1 1 203 5.0E-55
sp|Q8AWF2|NACA_ORENI Nascent polypeptide-associated complex subunit alpha OS=Oreochromis niloticus GN=naca PE=2 SV=1 47 203 2.0E-44
sp|Q60817|NACA_MOUSE Nascent polypeptide-associated complex subunit alpha OS=Mus musculus GN=Naca PE=1 SV=1 47 203 6.0E-44
sp|Q13765|NACA_HUMAN Nascent polypeptide-associated complex subunit alpha OS=Homo sapiens GN=NACA PE=1 SV=1 47 203 6.0E-44
sp|Q5E9A1|NACA_BOVIN Nascent polypeptide-associated complex subunit alpha OS=Bos taurus GN=NACA PE=1 SV=1 47 203 7.0E-44
sp|Q6IP73|NACA_XENLA Nascent polypeptide-associated complex subunit alpha OS=Xenopus laevis GN=naca PE=2 SV=1 47 203 7.0E-44
sp|Q68F90|NACA_XENTR Nascent polypeptide-associated complex subunit alpha OS=Xenopus tropicalis GN=naca PE=2 SV=1 47 203 9.0E-44
sp|Q9M612|NACA_PINTA Nascent polypeptide-associated complex subunit alpha-like protein OS=Pinus taeda PE=2 SV=1 47 202 4.0E-43
sp|Q8JIU7|NACA_DANRE Nascent polypeptide-associated complex subunit alpha OS=Danio rerio GN=naca PE=1 SV=1 47 203 4.0E-43
sp|Q94518|NACA_DROME Nascent polypeptide-associated complex subunit alpha OS=Drosophila melanogaster GN=Nacalpha PE=1 SV=2 47 203 1.0E-42
sp|Q6QN10|NACA_CHILA Nascent polypeptide-associated complex subunit alpha OS=Chinchilla lanigera PE=2 SV=1 47 203 2.0E-42
sp|P70670|NACAM_MOUSE Nascent polypeptide-associated complex subunit alpha, muscle-specific form OS=Mus musculus GN=Naca PE=1 SV=2 47 203 4.0E-42
sp|Q9BZK3|NACP1_HUMAN Putative nascent polypeptide-associated complex subunit alpha-like protein OS=Homo sapiens GN=NACAP1 PE=5 SV=1 47 203 4.0E-42
sp|Q5R9I9|NACA_PONAB Nascent polypeptide-associated complex subunit alpha OS=Pongo abelii GN=NACA PE=2 SV=1 47 203 7.0E-42
sp|Q86S66|NACA_CAEEL Nascent polypeptide-associated complex subunit alpha OS=Caenorhabditis elegans GN=icd-2 PE=1 SV=1 12 203 3.0E-41
sp|Q94JX9|NACA2_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 2 OS=Arabidopsis thaliana GN=At3g49470 PE=2 SV=2 47 202 4.0E-41
sp|Q9H009|NACA2_HUMAN Nascent polypeptide-associated complex subunit alpha-2 OS=Homo sapiens GN=NACA2 PE=1 SV=1 47 203 2.0E-40
sp|P87147|NACA_SCHPO Nascent polypeptide-associated complex subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=egd2 PE=1 SV=1 38 203 3.0E-40
sp|Q61UX1|NACA_CAEBR Nascent polypeptide-associated complex subunit alpha OS=Caenorhabditis briggsae GN=icd-2 PE=3 SV=1 4 203 1.0E-38
sp|Q9SZY1|NACA4_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 4 OS=Arabidopsis thaliana GN=At4g10480 PE=1 SV=1 47 202 3.0E-38
sp|O15069|NACAD_HUMAN NAC-alpha domain-containing protein 1 OS=Homo sapiens GN=NACAD PE=1 SV=3 47 203 8.0E-37
sp|Q9LHG9|NACA1_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 1 OS=Arabidopsis thaliana GN=At3g12390 PE=1 SV=1 47 202 8.0E-37
sp|Q8LGC6|NACA5_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 5 OS=Arabidopsis thaliana GN=At1g33040 PE=2 SV=2 47 202 1.0E-35
sp|Q6BSN9|NACA_DEBHA Nascent polypeptide-associated complex subunit alpha OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=EGD2 PE=3 SV=1 38 202 8.0E-35
sp|E9PAV3|NACAM_HUMAN Nascent polypeptide-associated complex subunit alpha, muscle-specific form OS=Homo sapiens GN=NACA PE=1 SV=1 47 203 9.0E-35
sp|Q5SWP3|NACAD_MOUSE NAC-alpha domain-containing protein 1 OS=Mus musculus GN=Nacad PE=1 SV=1 47 203 3.0E-34
sp|Q6ICZ8|NACA3_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 3 OS=Arabidopsis thaliana GN=At5g13850 PE=1 SV=1 47 202 5.0E-34
sp|Q45FF9|NACA_BABDI Nascent polypeptide-associated complex subunit alpha OS=Babesia divergens PE=2 SV=1 22 202 3.0E-33
sp|Q756T5|NACA_ASHGO Nascent polypeptide-associated complex subunit alpha OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=EGD2 PE=3 SV=1 38 202 1.0E-32
sp|Q4P341|NACA_USTMA Nascent polypeptide-associated complex subunit alpha OS=Ustilago maydis (strain 521 / FGSC 9021) GN=EGD2 PE=3 SV=1 6 199 5.0E-32
sp|A7TG43|NACA_VANPO Nascent polypeptide-associated complex subunit alpha OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=EGD2 PE=3 SV=1 37 202 1.0E-31
sp|A5DXK7|NACA_LODEL Nascent polypeptide-associated complex subunit alpha OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=EGD2 PE=3 SV=1 38 202 4.0E-31
sp|P0CP07|NACA_CRYNB Nascent polypeptide-associated complex subunit alpha OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=EGD2 PE=3 SV=1 33 201 2.0E-30
sp|P0CP06|NACA_CRYNJ Nascent polypeptide-associated complex subunit alpha OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=EGD2 PE=3 SV=1 33 201 3.0E-30
sp|A3GHD3|NACA_PICST Nascent polypeptide-associated complex subunit alpha OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=EGD2 PE=3 SV=1 38 202 3.0E-30
sp|Q6CDH0|NACA_YARLI Nascent polypeptide-associated complex subunit alpha OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=EGD2 PE=3 SV=1 25 202 4.0E-30
sp|A5DGN9|NACA_PICGU Nascent polypeptide-associated complex subunit alpha OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=EGD2 PE=3 SV=2 38 202 3.0E-29
sp|Q6FJD5|NACA_CANGA Nascent polypeptide-associated complex subunit alpha OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=EGD2 PE=3 SV=1 38 202 1.0E-27
sp|Q6CWG6|NACA_KLULA Nascent polypeptide-associated complex subunit alpha OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=EGD2 PE=3 SV=1 42 202 4.0E-27
sp|Q5ANP2|NACA_CANAL Nascent polypeptide-associated complex subunit alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EGD2 PE=3 SV=1 38 202 1.0E-25
sp|P38879|NACA_YEAST Nascent polypeptide-associated complex subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EGD2 PE=1 SV=3 37 202 4.0E-21
sp|A6ZT99|NACA_YEAS7 Nascent polypeptide-associated complex subunit alpha OS=Saccharomyces cerevisiae (strain YJM789) GN=EGD2 PE=3 SV=1 37 202 4.0E-21
sp|Q54U07|NACA_DICDI Nascent polypeptide-associated complex subunit alpha OS=Dictyostelium discoideum GN=nacA PE=3 SV=1 48 202 3.0E-20
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3599
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6621 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3097
Ophiocordyceps camponoti-floridani Ophcf2|00820
Ophiocordyceps camponoti-rufipedis Ophun1|3896
Ophiocordyceps kimflemingae Ophio5|600
Ophiocordyceps subramaniannii Hirsu2|6940

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6621
MANPRVEELPDDETQNPTVEHEDSSDESDAEEAGEGSLPAGSTAVIHSRNEKKARKALEKLHLTRVTGITRVTLR
RPKNILFVINNPEVYKSPNSNTYIVFGEAKIEDINANAQQAAAQQLAAAGAEGDHAGHNHGDTSKAVEGADAKKD
EEEDDGEEVDSEGLEDKDIDLVMTQASVSRKRAIKALKENDNDIVNSIMALSV*
Coding >OphauG2|6621
ATGGCGAACCCTCGAGTCGAAGAACTTCCGGACGATGAGACCCAAAACCCTACTGTCGAGCATGAGGACAGCAGT
GACGAGTCTGATGCTGAAGAGGCGGGCGAGGGTTCTCTGCCTGCTGGTTCTACCGCTGTGATCCATTCCCGCAAC
GAGAAGAAGGCTCGCAAGGCTCTGGAGAAGCTGCATTTGACTCGGGTTACGGGTATTACCCGCGTAACCTTGCGC
CGCCCAAAGAATATTCTCTTCGTCATTAACAATCCCGAAGTCTATAAATCTCCCAATAGCAACACTTACATCGTC
TTTGGCGAGGCTAAAATTGAAGACATTAATGCCAATGCTCAACAAGCCGCCGCCCAGCAGCTTGCTGCAGCTGGT
GCCGAGGGTGATCATGCCGGTCACAATCACGGAGATACCAGCAAGGCTGTTGAGGGTGCCGATGCCAAAAAGGAC
GAAGAAGAGGACGATGGTGAAGAGGTGGACTCTGAAGGGCTTGAAGACAAGGATATTGATTTGGTCATGACACAG
GCCAGCGTCAGTCGCAAAAGGGCAATCAAGGCGCTGAAAGAAAACGACAATGACATTGTCAATTCGATCATGGCC
TTGAGTGTTTAG
Transcript >OphauG2|6621
ATGGCGAACCCTCGAGTCGAAGAACTTCCGGACGATGAGACCCAAAACCCTACTGTCGAGCATGAGGACAGCAGT
GACGAGTCTGATGCTGAAGAGGCGGGCGAGGGTTCTCTGCCTGCTGGTTCTACCGCTGTGATCCATTCCCGCAAC
GAGAAGAAGGCTCGCAAGGCTCTGGAGAAGCTGCATTTGACTCGGGTTACGGGTATTACCCGCGTAACCTTGCGC
CGCCCAAAGAATATTCTCTTCGTCATTAACAATCCCGAAGTCTATAAATCTCCCAATAGCAACACTTACATCGTC
TTTGGCGAGGCTAAAATTGAAGACATTAATGCCAATGCTCAACAAGCCGCCGCCCAGCAGCTTGCTGCAGCTGGT
GCCGAGGGTGATCATGCCGGTCACAATCACGGAGATACCAGCAAGGCTGTTGAGGGTGCCGATGCCAAAAAGGAC
GAAGAAGAGGACGATGGTGAAGAGGTGGACTCTGAAGGGCTTGAAGACAAGGATATTGATTTGGTCATGACACAG
GCCAGCGTCAGTCGCAAAAGGGCAATCAAGGCGCTGAAAGAAAACGACAATGACATTGTCAATTCGATCATGGCC
TTGAGTGTTTAG
Gene >OphauG2|6621
ATGGCGAACCCTCGAGTCGAAGAACTTCCGGACGATGAGACCCAAAACCCTACTGTCGAGCATGAGGACAGCAGT
GACGAGTCTGATGCTGAAGAGGCGGGCGAGGGTTCTCTGCCTGCTGGTTCTACCGCTGTGATCCATTCCCGCAAC
GAGAAGAAGGCTCGCAAGGCTCTGGAGAAGCTGCATTTGACTCGGGTTACGGGTATTACCCGCGTAACCTTGCGC
CGCCCAAAGAATGTATGGGCACTTTTTAGTCTAACCTTGGGAAAAACTGAGCGCTAAATTCTGGAATCAGATTCT
CTTCGTCATTAACAATCCCGAAGTCTATAAATCTCCCAATAGCAACACTTACATGTAAGTGATGCTACCTGTTCG
TCAAAATCGCTTGGAGAGGCTCACTGTATTTGCAGCGTCTTTGGCGAGGCTAAAATTGAAGACATTAATGCCAAT
GCTCAACAAGCCGCCGCCCAGCAGCTTGCTGCAGCTGGTGCCGAGGGTGATCATGCCGGTCACAATCACGGAGAT
ACCAGCAAGGCTGTTGAGGGTGCCGATGCCAAAAAGGACGAAGAAGAGGACGATGGTGAAGAGGTGGACTCTGAA
GGGCTTGAAGACAAGGATATTGATTTGGTCATGACACAGGCCAGCGTCAGTCGCAAAAGGGCAATCAAGGCGCTG
AAAGAAAACGACAATGACATTGTCAATTCGATCATGGCCTTGAGTGTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail