Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|662
Gene name
LocationContig_1166:3941..5414
Strand+
Gene length (bp)1473
Transcript length (bp)1356
Coding sequence length (bp)1356
Protein length (aa) 452

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00318 Ribosomal_S2 Ribosomal protein S2 1.8E-65 151 346

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32902|RT04_YEAST 37S ribosomal protein MRP4, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRP4 PE=1 SV=1 100 351 5.0E-62
sp|O13970|RT04_SCHPO 37S ribosomal protein mrp4, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrp4 PE=3 SV=2 102 345 9.0E-52
sp|A7HMF2|RS2_FERNB 30S ribosomal protein S2 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=rpsB PE=3 SV=1 146 366 8.0E-36
sp|P80371|RS2_THET8 30S ribosomal protein S2 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpsB PE=1 SV=4 143 335 9.0E-35
sp|P62662|RS2_THET2 30S ribosomal protein S2 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpsB PE=1 SV=2 143 335 9.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32902|RT04_YEAST 37S ribosomal protein MRP4, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRP4 PE=1 SV=1 100 351 5.0E-62
sp|O13970|RT04_SCHPO 37S ribosomal protein mrp4, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrp4 PE=3 SV=2 102 345 9.0E-52
sp|A7HMF2|RS2_FERNB 30S ribosomal protein S2 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=rpsB PE=3 SV=1 146 366 8.0E-36
sp|P80371|RS2_THET8 30S ribosomal protein S2 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpsB PE=1 SV=4 143 335 9.0E-35
sp|P62662|RS2_THET2 30S ribosomal protein S2 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpsB PE=1 SV=2 143 335 9.0E-35
sp|O67809|RS2_AQUAE 30S ribosomal protein S2 OS=Aquifex aeolicus (strain VF5) GN=rpsB PE=3 SV=1 146 360 6.0E-33
sp|A8MHG9|RS2_ALKOO 30S ribosomal protein S2 OS=Alkaliphilus oremlandii (strain OhILAs) GN=rpsB PE=3 SV=1 146 347 1.0E-32
sp|Q2RJP3|RS2_MOOTA 30S ribosomal protein S2 OS=Moorella thermoacetica (strain ATCC 39073) GN=rpsB PE=3 SV=1 146 355 2.0E-32
sp|A5GTG8|RS2_SYNR3 30S ribosomal protein S2 OS=Synechococcus sp. (strain RCC307) GN=rpsB PE=3 SV=1 146 347 3.0E-32
sp|B1WQZ8|RS2_CYAA5 30S ribosomal protein S2 OS=Cyanothece sp. (strain ATCC 51142) GN=rpsB PE=3 SV=1 146 351 4.0E-32
sp|Q24UF7|RS2_DESHY 30S ribosomal protein S2 OS=Desulfitobacterium hafniense (strain Y51) GN=rpsB PE=3 SV=1 146 348 5.0E-32
sp|B8FRG5|RS2_DESHD 30S ribosomal protein S2 OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=rpsB PE=3 SV=1 146 348 5.0E-32
sp|B0JTL2|RS2_MICAN 30S ribosomal protein S2 OS=Microcystis aeruginosa (strain NIES-843) GN=rpsB PE=3 SV=1 146 346 7.0E-32
sp|B7IHT3|RS2_THEAB 30S ribosomal protein S2 OS=Thermosipho africanus (strain TCF52B) GN=rpsB PE=3 SV=1 146 348 9.0E-32
sp|B5YEG9|RS2_DICT6 30S ribosomal protein S2 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=rpsB PE=3 SV=1 146 354 1.0E-31
sp|Q65JJ9|RS2_BACLD 30S ribosomal protein S2 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rpsB PE=3 SV=1 146 357 1.0E-31
sp|B8E2Y2|RS2_DICTD 30S ribosomal protein S2 OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=rpsB PE=3 SV=1 146 354 2.0E-31
sp|B3E716|RS2_GEOLS 30S ribosomal protein S2 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=rpsB PE=3 SV=1 146 358 2.0E-31
sp|A4IMC3|RS2_GEOTN 30S ribosomal protein S2 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rpsB PE=3 SV=1 146 342 2.0E-31
sp|C4XMY2|RS2_DESMR 30S ribosomal protein S2 OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=rpsB PE=3 SV=1 146 349 3.0E-31
sp|Q8DS11|RS2_STRMU 30S ribosomal protein S2 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rpsB PE=3 SV=1 146 348 3.0E-31
sp|B5Y8I9|RS2_COPPD 30S ribosomal protein S2 OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=rpsB PE=3 SV=1 146 359 3.0E-31
sp|A7H716|RS2_ANADF 30S ribosomal protein S2 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rpsB PE=3 SV=1 146 356 3.0E-31
sp|Q1D1H9|RS2_MYXXD 30S ribosomal protein S2 OS=Myxococcus xanthus (strain DK 1622) GN=rpsB PE=3 SV=1 146 346 3.0E-31
sp|C5D9B5|RS2_GEOSW 30S ribosomal protein S2 OS=Geobacillus sp. (strain WCH70) GN=rpsB PE=3 SV=1 146 342 3.0E-31
sp|A1USD9|RS2_BARBK 30S ribosomal protein S2 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rpsB PE=3 SV=1 145 346 3.0E-31
sp|Q4L5V8|RS2_STAHJ 30S ribosomal protein S2 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpsB PE=3 SV=1 146 346 4.0E-31
sp|Q8CSU2|RS2_STAES 30S ribosomal protein S2 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rpsB PE=3 SV=1 146 346 6.0E-31
sp|Q5HPT5|RS2_STAEQ 30S ribosomal protein S2 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rpsB PE=3 SV=1 146 346 6.0E-31
sp|B1HQZ0|RS2_LYSSC 30S ribosomal protein S2 OS=Lysinibacillus sphaericus (strain C3-41) GN=rpsB PE=3 SV=2 146 342 6.0E-31
sp|P21464|RS2_BACSU 30S ribosomal protein S2 OS=Bacillus subtilis (strain 168) GN=rpsB PE=1 SV=3 146 357 8.0E-31
sp|A6LLI6|RS2_THEM4 30S ribosomal protein S2 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rpsB PE=3 SV=1 146 348 9.0E-31
sp|A9ISJ8|RS2_BART1 30S ribosomal protein S2 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rpsB PE=3 SV=2 145 346 1.0E-30
sp|C3MBQ2|RS2_RHISN 30S ribosomal protein S2 OS=Rhizobium sp. (strain NGR234) GN=rpsB PE=3 SV=1 145 346 1.0E-30
sp|Q1IU82|RS2_KORVE 30S ribosomal protein S2 OS=Koribacter versatilis (strain Ellin345) GN=rpsB PE=3 SV=1 145 346 1.0E-30
sp|Q49X41|RS2_STAS1 30S ribosomal protein S2 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rpsB PE=3 SV=1 146 346 1.0E-30
sp|B9LEM0|RS2_CHLSY 30S ribosomal protein S2 OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=rpsB PE=3 SV=1 141 356 1.0E-30
sp|A9WAF9|RS2_CHLAA 30S ribosomal protein S2 OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=rpsB PE=3 SV=1 141 356 1.0E-30
sp|Q5FJM3|RS2_LACAC 30S ribosomal protein S2 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rpsB PE=3 SV=1 146 358 2.0E-30
sp|A8F717|RS2_PSELT 30S ribosomal protein S2 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=rpsB PE=3 SV=1 146 348 2.0E-30
sp|Q1IZI6|RS2_DEIGD 30S ribosomal protein S2 OS=Deinococcus geothermalis (strain DSM 11300) GN=rpsB PE=3 SV=1 146 340 2.0E-30
sp|P66545|RS2_STAAW 30S ribosomal protein S2 OS=Staphylococcus aureus (strain MW2) GN=rpsB PE=3 SV=1 146 346 2.0E-30
sp|A8Z3T6|RS2_STAAT 30S ribosomal protein S2 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=rpsB PE=3 SV=1 146 346 2.0E-30
sp|Q6G9V7|RS2_STAAS 30S ribosomal protein S2 OS=Staphylococcus aureus (strain MSSA476) GN=rpsB PE=3 SV=1 146 346 2.0E-30
sp|Q6GHH9|RS2_STAAR 30S ribosomal protein S2 OS=Staphylococcus aureus (strain MRSA252) GN=rpsB PE=3 SV=1 146 346 2.0E-30
sp|P66544|RS2_STAAN 30S ribosomal protein S2 OS=Staphylococcus aureus (strain N315) GN=rpsB PE=1 SV=1 146 346 2.0E-30
sp|P66543|RS2_STAAM 30S ribosomal protein S2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rpsB PE=3 SV=1 146 346 2.0E-30
sp|A6QGF6|RS2_STAAE 30S ribosomal protein S2 OS=Staphylococcus aureus (strain Newman) GN=rpsB PE=3 SV=1 146 346 2.0E-30
sp|Q2YXL2|RS2_STAAB 30S ribosomal protein S2 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rpsB PE=3 SV=1 146 346 2.0E-30
sp|Q2FZ25|RS2_STAA8 30S ribosomal protein S2 OS=Staphylococcus aureus (strain NCTC 8325) GN=rpsB PE=3 SV=2 146 346 2.0E-30
sp|Q2FHI2|RS2_STAA3 30S ribosomal protein S2 OS=Staphylococcus aureus (strain USA300) GN=rpsB PE=3 SV=1 146 346 2.0E-30
sp|A7X1N3|RS2_STAA1 30S ribosomal protein S2 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rpsB PE=3 SV=1 146 346 2.0E-30
sp|Q1R033|RS2_CHRSD 30S ribosomal protein S2 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rpsB PE=3 SV=1 146 356 2.0E-30
sp|B0TP83|RS2_SHEHH 30S ribosomal protein S2 OS=Shewanella halifaxensis (strain HAW-EB4) GN=rpsB PE=3 SV=1 146 356 3.0E-30
sp|Q3AB77|RS2_CARHZ 30S ribosomal protein S2 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rpsB PE=3 SV=1 146 347 3.0E-30
sp|Q5L0K2|RS2_GEOKA 30S ribosomal protein S2 OS=Geobacillus kaustophilus (strain HTA426) GN=rpsB PE=3 SV=1 146 342 3.0E-30
sp|Q044D0|RS2_LACGA 30S ribosomal protein S2 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rpsB PE=3 SV=2 146 348 3.0E-30
sp|Q1XDN8|RR2_PYRYE 30S ribosomal protein S2, chloroplastic OS=Pyropia yezoensis GN=rps2 PE=3 SV=1 146 347 3.0E-30
sp|A5ISE0|RS2_STAA9 30S ribosomal protein S2 OS=Staphylococcus aureus (strain JH9) GN=rpsB PE=3 SV=1 146 346 3.0E-30
sp|A6U174|RS2_STAA2 30S ribosomal protein S2 OS=Staphylococcus aureus (strain JH1) GN=rpsB PE=3 SV=1 146 346 3.0E-30
sp|A1AQN2|RS2_PELPD 30S ribosomal protein S2 OS=Pelobacter propionicus (strain DSM 2379) GN=rpsB PE=3 SV=1 146 363 3.0E-30
sp|A9B458|RS2_HERA2 30S ribosomal protein S2 OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=rpsB PE=3 SV=1 146 350 3.0E-30
sp|B1XQQ1|RS2_SYNP2 30S ribosomal protein S2 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=rpsB PE=3 SV=1 146 347 4.0E-30
sp|Q31G43|RS2_THICR 30S ribosomal protein S2 OS=Thiomicrospira crunogena (strain XCL-2) GN=rpsB PE=3 SV=2 146 347 4.0E-30
sp|Q5HGH6|RS2_STAAC 30S ribosomal protein S2 OS=Staphylococcus aureus (strain COL) GN=rpsB PE=3 SV=1 146 346 4.0E-30
sp|Q74IR7|RS2_LACJO 30S ribosomal protein S2 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rpsB PE=3 SV=1 146 348 4.0E-30
sp|A7Z4S0|RS2_BACMF 30S ribosomal protein S2 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rpsB PE=3 SV=1 146 357 4.0E-30
sp|A8AZP1|RS2_STRGC 30S ribosomal protein S2 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rpsB PE=3 SV=1 146 348 5.0E-30
sp|Q831U9|RS2_ENTFA 30S ribosomal protein S2 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rpsB PE=3 SV=1 146 363 5.0E-30
sp|C0ZF66|RS2_BREBN 30S ribosomal protein S2 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rpsB PE=3 SV=1 146 350 5.0E-30
sp|B7GG89|RS2_ANOFW 30S ribosomal protein S2 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rpsB PE=3 SV=1 146 365 6.0E-30
sp|A6U8K2|RS2_SINMW 30S ribosomal protein S2 OS=Sinorhizobium medicae (strain WSM419) GN=rpsB PE=3 SV=1 145 346 6.0E-30
sp|B3EU84|RS2_AMOA5 30S ribosomal protein S2 OS=Amoebophilus asiaticus (strain 5a2) GN=rpsB PE=3 SV=1 146 355 6.0E-30
sp|Q6HEY8|RS2_BACHK 30S ribosomal protein S2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rpsB PE=3 SV=1 146 342 6.0E-30
sp|Q636J9|RS2_BACCZ 30S ribosomal protein S2 OS=Bacillus cereus (strain ZK / E33L) GN=rpsB PE=3 SV=1 146 342 6.0E-30
sp|B9IVB6|RS2_BACCQ 30S ribosomal protein S2 OS=Bacillus cereus (strain Q1) GN=rpsB PE=3 SV=1 146 342 6.0E-30
sp|B7HLG0|RS2_BACC7 30S ribosomal protein S2 OS=Bacillus cereus (strain AH187) GN=rpsB PE=3 SV=1 146 342 6.0E-30
sp|C1EP51|RS2_BACC3 30S ribosomal protein S2 OS=Bacillus cereus (strain 03BB102) GN=rpsB PE=3 SV=1 146 342 6.0E-30
sp|Q9XBK3|RS2_BACC1 30S ribosomal protein S2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rpsB PE=3 SV=2 146 342 6.0E-30
sp|B7JJA5|RS2_BACC0 30S ribosomal protein S2 OS=Bacillus cereus (strain AH820) GN=rpsB PE=3 SV=1 146 342 6.0E-30
sp|Q81WK8|RS2_BACAN 30S ribosomal protein S2 OS=Bacillus anthracis GN=rpsB PE=3 SV=1 146 342 6.0E-30
sp|A0RHK0|RS2_BACAH 30S ribosomal protein S2 OS=Bacillus thuringiensis (strain Al Hakam) GN=rpsB PE=3 SV=1 146 342 6.0E-30
sp|C3L7A0|RS2_BACAC 30S ribosomal protein S2 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=rpsB PE=3 SV=1 146 342 6.0E-30
sp|C3P5M9|RS2_BACAA 30S ribosomal protein S2 OS=Bacillus anthracis (strain A0248) GN=rpsB PE=3 SV=1 146 342 6.0E-30
sp|Q2NBU6|RS2_ERYLH 30S ribosomal protein S2 OS=Erythrobacter litoralis (strain HTCC2594) GN=rpsB PE=3 SV=2 146 345 6.0E-30
sp|Q185S8|RS2_PEPD6 30S ribosomal protein S2 OS=Peptoclostridium difficile (strain 630) GN=rpsB PE=3 SV=1 146 353 7.0E-30
sp|Q819X9|RS2_BACCR 30S ribosomal protein S2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rpsB PE=3 SV=1 146 342 7.0E-30
sp|B7HDV0|RS2_BACC4 30S ribosomal protein S2 OS=Bacillus cereus (strain B4264) GN=rpsB PE=3 SV=1 146 342 7.0E-30
sp|B7IUI6|RS2_BACC2 30S ribosomal protein S2 OS=Bacillus cereus (strain G9842) GN=rpsB PE=3 SV=1 146 342 7.0E-30
sp|Q6FA53|RS2_ACIAD 30S ribosomal protein S2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rpsB PE=3 SV=1 145 348 7.0E-30
sp|Q9RU79|RS2_DEIRA 30S ribosomal protein S2 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=rpsB PE=3 SV=1 146 340 7.0E-30
sp|Q116Q2|RS2_TRIEI 30S ribosomal protein S2 OS=Trichodesmium erythraeum (strain IMS101) GN=rpsB PE=3 SV=1 146 347 8.0E-30
sp|A7GRF7|RS2_BACCN 30S ribosomal protein S2 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rpsB PE=3 SV=1 146 342 8.0E-30
sp|P74071|RS2_SYNY3 30S ribosomal protein S2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rpsB PE=3 SV=1 146 347 8.0E-30
sp|B9EBD6|RS2_MACCJ 30S ribosomal protein S2 OS=Macrococcus caseolyticus (strain JCSC5402) GN=rpsB PE=3 SV=1 146 347 9.0E-30
sp|A3CQW3|RS2_STRSV 30S ribosomal protein S2 OS=Streptococcus sanguinis (strain SK36) GN=rpsB PE=3 SV=1 146 348 9.0E-30
sp|Q8EQV3|RS2_OCEIH 30S ribosomal protein S2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rpsB PE=3 SV=1 146 342 9.0E-30
sp|A9VT65|RS2_BACWK 30S ribosomal protein S2 OS=Bacillus weihenstephanensis (strain KBAB4) GN=rpsB PE=3 SV=1 146 342 9.0E-30
sp|Q7VCB6|RS2_PROMA 30S ribosomal protein S2 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=rpsB PE=3 SV=1 146 353 1.0E-29
sp|C6C1T1|RS2_DESAD 30S ribosomal protein S2 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=rpsB PE=3 SV=1 146 355 1.0E-29
sp|A8YVR9|RS2_LACH4 30S ribosomal protein S2 OS=Lactobacillus helveticus (strain DPC 4571) GN=rpsB PE=3 SV=1 146 358 1.0E-29
sp|Q92Q55|RS2_RHIME 30S ribosomal protein S2 OS=Rhizobium meliloti (strain 1021) GN=rpsB PE=3 SV=1 145 346 1.0E-29
sp|B6ISV1|RS2_RHOCS 30S ribosomal protein S2 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rpsB PE=3 SV=1 147 332 1.0E-29
sp|A1U3Q4|RS2_MARHV 30S ribosomal protein S2 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rpsB PE=3 SV=1 146 334 1.0E-29
sp|A9BAS9|RS2_PROM4 30S ribosomal protein S2 OS=Prochlorococcus marinus (strain MIT 9211) GN=rpsB PE=3 SV=1 146 347 1.0E-29
sp|Q0G9X3|RR2_DAUCA 30S ribosomal protein S2, chloroplastic OS=Daucus carota GN=rps2 PE=3 SV=1 145 353 1.0E-29
sp|B8CW53|RS2_HALOH 30S ribosomal protein S2 OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=rpsB PE=3 SV=1 146 356 1.0E-29
sp|B1X437|RR2_PAUCH 30S ribosomal protein S2, organellar chromatophore OS=Paulinella chromatophora GN=rps2 PE=3 SV=1 146 357 1.0E-29
sp|A6TRM3|RS2_ALKMQ 30S ribosomal protein S2 OS=Alkaliphilus metalliredigens (strain QYMF) GN=rpsB PE=3 SV=1 146 347 1.0E-29
sp|B8G458|RS2_CHLAD 30S ribosomal protein S2 OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=rpsB PE=3 SV=1 143 356 1.0E-29
sp|B9DPG8|RS2_STACT 30S ribosomal protein S2 OS=Staphylococcus carnosus (strain TM300) GN=rpsB PE=3 SV=1 146 346 1.0E-29
sp|Q6G5C9|RS2_BARHE 30S ribosomal protein S2 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rpsB PE=3 SV=1 145 346 1.0E-29
sp|A4XM02|RS2_CALS8 30S ribosomal protein S2 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rpsB PE=3 SV=1 146 348 1.0E-29
sp|Q6FZN0|RS2_BARQU 30S ribosomal protein S2 OS=Bartonella quintana (strain Toulouse) GN=rpsB PE=3 SV=1 145 346 1.0E-29
sp|Q9KA63|RS2_BACHD 30S ribosomal protein S2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rpsB PE=3 SV=1 146 342 1.0E-29
sp|Q3ZZC1|RS2_DEHMC 30S ribosomal protein S2 OS=Dehalococcoides mccartyi (strain CBDB1) GN=rpsB PE=3 SV=1 151 342 1.0E-29
sp|A5FS79|RS2_DEHMB 30S ribosomal protein S2 OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=rpsB PE=3 SV=1 151 342 1.0E-29
sp|Q67PB7|RS2_SYMTH 30S ribosomal protein S2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=rpsB PE=3 SV=1 146 348 2.0E-29
sp|P51249|RR2_PORPU 30S ribosomal protein S2, chloroplastic OS=Porphyra purpurea GN=rps2 PE=3 SV=1 146 347 2.0E-29
sp|C1CVN8|RS2_DEIDV 30S ribosomal protein S2 OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=rpsB PE=3 SV=2 146 340 2.0E-29
sp|C0MEG6|RS2_STRS7 30S ribosomal protein S2 OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rpsB PE=3 SV=1 146 348 2.0E-29
sp|C0MAG7|RS2_STRE4 30S ribosomal protein S2 OS=Streptococcus equi subsp. equi (strain 4047) GN=rpsB PE=3 SV=1 146 348 2.0E-29
sp|B8FGE6|RS2_DESAA 30S ribosomal protein S2 OS=Desulfatibacillum alkenivorans (strain AK-01) GN=rpsB PE=3 SV=1 146 347 2.0E-29
sp|B7K4S8|RS2_CYAP8 30S ribosomal protein S2 OS=Cyanothece sp. (strain PCC 8801) GN=rpsB PE=3 SV=1 146 351 2.0E-29
sp|Q8RA21|RS2_CALS4 30S ribosomal protein S2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpsB PE=3 SV=1 146 356 2.0E-29
sp|B9DW41|RS2_STRU0 30S ribosomal protein S2 OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rpsB PE=3 SV=1 146 348 3.0E-29
sp|Q09G57|RR2_PLAOC 30S ribosomal protein S2, chloroplastic OS=Platanus occidentalis GN=rps2 PE=3 SV=1 145 353 3.0E-29
sp|B8DSA6|RS2_DESVM 30S ribosomal protein S2 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=rpsB PE=3 SV=1 146 350 3.0E-29
sp|Q3AKA5|RS2_SYNSC 30S ribosomal protein S2 OS=Synechococcus sp. (strain CC9605) GN=rpsB PE=3 SV=2 146 350 3.0E-29
sp|A6X0J1|RS2_OCHA4 30S ribosomal protein S2 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rpsB PE=3 SV=1 145 346 3.0E-29
sp|A1VFA8|RS2_DESVV 30S ribosomal protein S2 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=rpsB PE=3 SV=1 146 346 3.0E-29
sp|Q72DQ5|RS2_DESVH 30S ribosomal protein S2 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=rpsB PE=3 SV=1 146 346 3.0E-29
sp|Q485H0|RS2_COLP3 30S ribosomal protein S2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rpsB PE=3 SV=1 145 351 3.0E-29
sp|Q5FUV7|RS2_GLUOX 30S ribosomal protein S2 OS=Gluconobacter oxydans (strain 621H) GN=rpsB PE=3 SV=1 145 356 4.0E-29
sp|B9MKQ1|RS2_CALBD 30S ribosomal protein S2 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rpsB PE=3 SV=1 146 348 4.0E-29
sp|B4UMB8|RS2_ANASK 30S ribosomal protein S2 OS=Anaeromyxobacter sp. (strain K) GN=rpsB PE=3 SV=1 146 347 4.0E-29
sp|Q2IML9|RS2_ANADE 30S ribosomal protein S2 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rpsB PE=3 SV=2 146 347 4.0E-29
sp|Q3BAQ3|RR2_PHAAO 30S ribosomal protein S2, chloroplastic OS=Phalaenopsis aphrodite subsp. formosana GN=rps2 PE=3 SV=1 145 353 4.0E-29
sp|B2UB06|RS2_RALPJ 30S ribosomal protein S2 OS=Ralstonia pickettii (strain 12J) GN=rpsB PE=3 SV=1 146 357 4.0E-29
sp|B5ZN83|RS2_RHILW 30S ribosomal protein S2 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rpsB PE=3 SV=1 145 346 4.0E-29
sp|Q2K8Y7|RS2_RHIEC 30S ribosomal protein S2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rpsB PE=3 SV=1 145 346 4.0E-29
sp|Q9WZM1|RS2_THEMA 30S ribosomal protein S2 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rpsB PE=3 SV=1 146 348 4.0E-29
sp|B3PYP2|RS2_RHIE6 30S ribosomal protein S2 OS=Rhizobium etli (strain CIAT 652) GN=rpsB PE=3 SV=1 145 346 4.0E-29
sp|Q049U2|RS2_LACDB 30S ribosomal protein S2 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rpsB PE=3 SV=1 146 347 4.0E-29
sp|Q1G9N6|RS2_LACDA 30S ribosomal protein S2 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rpsB PE=3 SV=1 146 347 4.0E-29
sp|A0L8Q5|RS2_MAGMM 30S ribosomal protein S2 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rpsB PE=3 SV=1 151 342 4.0E-29
sp|A0KHG3|RS2_AERHH 30S ribosomal protein S2 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rpsB PE=3 SV=1 146 332 5.0E-29
sp|A8H6L6|RS2_SHEPA 30S ribosomal protein S2 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rpsB PE=3 SV=1 146 356 5.0E-29
sp|Q1MH54|RS2_RHIL3 30S ribosomal protein S2 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rpsB PE=3 SV=1 145 346 5.0E-29
sp|A5CQS5|RS2_CLAM3 30S ribosomal protein S2 OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=rpsB PE=3 SV=1 146 360 5.0E-29
sp|A5VQT3|RS2_BRUO2 30S ribosomal protein S2 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rpsB PE=3 SV=1 145 346 6.0E-29
sp|Q8G0D6|RS2_BRUSU 30S ribosomal protein S2 OS=Brucella suis biovar 1 (strain 1330) GN=rpsB PE=3 SV=1 145 346 6.0E-29
sp|B0CGV9|RS2_BRUSI 30S ribosomal protein S2 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rpsB PE=3 SV=1 145 346 6.0E-29
sp|C0RJD0|RS2_BRUMB 30S ribosomal protein S2 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rpsB PE=3 SV=1 145 346 6.0E-29
sp|A9M5H4|RS2_BRUC2 30S ribosomal protein S2 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rpsB PE=3 SV=1 145 346 6.0E-29
sp|Q57CX7|RS2_BRUAB 30S ribosomal protein S2 OS=Brucella abortus biovar 1 (strain 9-941) GN=rpsB PE=3 SV=1 145 346 6.0E-29
sp|Q2YRJ1|RS2_BRUA2 30S ribosomal protein S2 OS=Brucella abortus (strain 2308) GN=rpsB PE=3 SV=1 145 346 6.0E-29
sp|B2S611|RS2_BRUA1 30S ribosomal protein S2 OS=Brucella abortus (strain S19) GN=rpsB PE=3 SV=1 145 346 6.0E-29
sp|A9NHC6|RS2_ACHLI 30S ribosomal protein S2 OS=Acholeplasma laidlawii (strain PG-8A) GN=rpsB PE=3 SV=1 146 342 7.0E-29
sp|Q2SBP7|RS2_HAHCH 30S ribosomal protein S2 OS=Hahella chejuensis (strain KCTC 2396) GN=rpsB PE=3 SV=1 145 346 7.0E-29
sp|P16037|RR2_MAIZE 30S ribosomal protein S2, chloroplastic OS=Zea mays GN=rps2 PE=3 SV=1 145 353 7.0E-29
sp|A4VJS1|RS2_PSEU5 30S ribosomal protein S2 OS=Pseudomonas stutzeri (strain A1501) GN=rpsB PE=3 SV=1 146 347 8.0E-29
sp|B0C075|RS2_ACAM1 30S ribosomal protein S2 OS=Acaryochloris marina (strain MBIC 11017) GN=rpsB PE=3 SV=1 146 347 8.0E-29
sp|A4W453|RS2_STRS2 30S ribosomal protein S2 OS=Streptococcus suis (strain 98HAH33) GN=rpsB PE=3 SV=2 146 348 8.0E-29
sp|A1XGM7|RR2_RANMC 30S ribosomal protein S2, chloroplastic OS=Ranunculus macranthus GN=rps2 PE=3 SV=1 145 353 8.0E-29
sp|A7GWR7|RS2_CAMC5 30S ribosomal protein S2 OS=Campylobacter curvus (strain 525.92) GN=rpsB PE=3 SV=2 146 347 9.0E-29
sp|B3WES8|RS2_LACCB 30S ribosomal protein S2 OS=Lactobacillus casei (strain BL23) GN=rpsB PE=3 SV=1 146 349 9.0E-29
sp|Q038L2|RS2_LACC3 30S ribosomal protein S2 OS=Lactobacillus casei (strain ATCC 334) GN=rpsB PE=3 SV=1 146 349 9.0E-29
sp|Q3Z9H6|RS2_DEHM1 30S ribosomal protein S2 OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rpsB PE=3 SV=1 151 342 1.0E-28
sp|B1JQG0|RS2_YERPY 30S ribosomal protein S2 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rpsB PE=3 SV=1 146 358 1.0E-28
sp|Q667I9|RS2_YERPS 30S ribosomal protein S2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rpsB PE=3 SV=1 146 358 1.0E-28
sp|A4TL92|RS2_YERPP 30S ribosomal protein S2 OS=Yersinia pestis (strain Pestoides F) GN=rpsB PE=3 SV=1 146 358 1.0E-28
sp|Q1CFE6|RS2_YERPN 30S ribosomal protein S2 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rpsB PE=3 SV=1 146 358 1.0E-28
sp|A9R396|RS2_YERPG 30S ribosomal protein S2 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rpsB PE=3 SV=1 146 358 1.0E-28
sp|Q8ZH66|RS2_YERPE 30S ribosomal protein S2 OS=Yersinia pestis GN=rpsB PE=3 SV=1 146 358 1.0E-28
sp|B2JZ34|RS2_YERPB 30S ribosomal protein S2 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rpsB PE=3 SV=1 146 358 1.0E-28
sp|Q1CAN6|RS2_YERPA 30S ribosomal protein S2 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rpsB PE=3 SV=1 146 358 1.0E-28
sp|A7FFG9|RS2_YERP3 30S ribosomal protein S2 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rpsB PE=3 SV=1 146 358 1.0E-28
sp|Q313G2|RS2_DESAG 30S ribosomal protein S2 OS=Desulfovibrio alaskensis (strain G20) GN=rpsB PE=3 SV=1 146 356 1.0E-28
sp|B8CQ85|RS2_SHEPW 30S ribosomal protein S2 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rpsB PE=3 SV=1 146 356 1.0E-28
sp|P49668|RS2_PEDAC 30S ribosomal protein S2 OS=Pediococcus acidilactici GN=rpsB PE=3 SV=1 146 356 1.0E-28
sp|A1B8E9|RS2_PARDP 30S ribosomal protein S2 OS=Paracoccus denitrificans (strain Pd 1222) GN=rpsB PE=3 SV=1 145 346 1.0E-28
sp|B0REP4|RS2_CLAMS 30S ribosomal protein S2 OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=rpsB PE=3 SV=1 146 360 1.0E-28
sp|P08241|RR2_PEA 30S ribosomal protein S2, chloroplastic OS=Pisum sativum GN=rps2 PE=3 SV=1 145 353 1.0E-28
sp|A4J5Z3|RS2_DESRM 30S ribosomal protein S2 OS=Desulfotomaculum reducens (strain MI-1) GN=rpsB PE=3 SV=1 146 347 1.0E-28
sp|Q4G3A3|RR2_EMIHU 30S ribosomal protein S2, chloroplastic OS=Emiliania huxleyi GN=rps2 PE=3 SV=1 146 347 1.0E-28
sp|Q8RIH7|RS2_FUSNN 30S ribosomal protein S2 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=rpsB PE=3 SV=1 146 346 1.0E-28
sp|Q1H139|RS2_METFK 30S ribosomal protein S2 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=rpsB PE=3 SV=1 146 356 1.0E-28
sp|Q11IJ8|RS2_CHESB 30S ribosomal protein S2 OS=Chelativorans sp. (strain BNC1) GN=rpsB PE=3 SV=1 145 346 1.0E-28
sp|A1EA01|RR2_AGRST 30S ribosomal protein S2, chloroplastic OS=Agrostis stolonifera GN=rps2 PE=3 SV=1 145 353 1.0E-28
sp|A9QC56|RR2_TRACE 30S ribosomal protein S2, chloroplastic OS=Trachelium caeruleum GN=rps2 PE=3 SV=1 145 347 1.0E-28
sp|A4VXV7|RS2_STRSY 30S ribosomal protein S2 OS=Streptococcus suis (strain 05ZYH33) GN=rpsB PE=3 SV=2 146 348 1.0E-28
sp|Q2L162|RS2_BORA1 30S ribosomal protein S2 OS=Bordetella avium (strain 197N) GN=rpsB PE=3 SV=1 151 351 1.0E-28
sp|A2RNV0|RS2_LACLM 30S ribosomal protein S2 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rpsB PE=3 SV=1 146 348 1.0E-28
sp|A5GLE0|RS2_SYNPW 30S ribosomal protein S2 OS=Synechococcus sp. (strain WH7803) GN=rpsB PE=3 SV=1 146 347 1.0E-28
sp|Q8UFM3|RS2_AGRFC 30S ribosomal protein S2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rpsB PE=3 SV=1 145 346 1.0E-28
sp|Q8FP70|RS2_COREF 30S ribosomal protein S2 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=rpsB PE=3 SV=1 146 350 1.0E-28
sp|Q02VX8|RS2_LACLS 30S ribosomal protein S2 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rpsB PE=3 SV=1 146 348 1.0E-28
sp|B5YGD9|RS2_THEYD 30S ribosomal protein S2 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=rpsB PE=3 SV=1 146 358 2.0E-28
sp|Q9CDR4|RS2_LACLA 30S ribosomal protein S2 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rpsB PE=3 SV=1 146 348 2.0E-28
sp|Q3IIX4|RS2_PSEHT 30S ribosomal protein S2 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rpsB PE=3 SV=1 145 356 2.0E-28
sp|A4SQI2|RS2_AERS4 30S ribosomal protein S2 OS=Aeromonas salmonicida (strain A449) GN=rpsB PE=3 SV=1 146 332 2.0E-28
sp|B6JH66|RS2_OLICO 30S ribosomal protein S2 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rpsB PE=3 SV=1 145 346 2.0E-28
sp|A5V3G2|RS2_SPHWW 30S ribosomal protein S2 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rpsB PE=3 SV=1 146 346 2.0E-28
sp|Q07NJ3|RS2_RHOP5 30S ribosomal protein S2 OS=Rhodopseudomonas palustris (strain BisA53) GN=rpsB PE=3 SV=1 141 342 2.0E-28
sp|Q03FT6|RS2_PEDPA 30S ribosomal protein S2 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rpsB PE=3 SV=1 146 356 2.0E-28
sp|B2FIA9|RS2_STRMK 30S ribosomal protein S2 OS=Stenotrophomonas maltophilia (strain K279a) GN=rpsB PE=3 SV=1 146 347 2.0E-28
sp|A4QJS2|RR2_OLIPU 30S ribosomal protein S2, chloroplastic OS=Olimarabidopsis pumila GN=rps2 PE=3 SV=1 145 354 2.0E-28
sp|P56797|RR2_ARATH 30S ribosomal protein S2, chloroplastic OS=Arabidopsis thaliana GN=rps2 PE=3 SV=1 145 354 2.0E-28
sp|P17933|RR2_WHEAT 30S ribosomal protein S2, chloroplastic OS=Triticum aestivum GN=rps2 PE=3 SV=2 145 353 3.0E-28
sp|A1E9I4|RR2_HORVU 30S ribosomal protein S2, chloroplastic OS=Hordeum vulgare GN=rps2 PE=3 SV=1 145 353 3.0E-28
sp|P66541|RS2_SALTY 30S ribosomal protein S2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rpsB PE=3 SV=2 146 359 3.0E-28
sp|P66542|RS2_SALTI 30S ribosomal protein S2 OS=Salmonella typhi GN=rpsB PE=3 SV=2 146 359 3.0E-28
sp|B4TXS1|RS2_SALSV 30S ribosomal protein S2 OS=Salmonella schwarzengrund (strain CVM19633) GN=rpsB PE=3 SV=1 146 359 3.0E-28
sp|B5BAM6|RS2_SALPK 30S ribosomal protein S2 OS=Salmonella paratyphi A (strain AKU_12601) GN=rpsB PE=3 SV=1 146 359 3.0E-28
sp|A9N0R7|RS2_SALPB 30S ribosomal protein S2 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rpsB PE=3 SV=2 146 359 3.0E-28
sp|Q5PD63|RS2_SALPA 30S ribosomal protein S2 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rpsB PE=3 SV=3 146 359 3.0E-28
sp|B4SUZ8|RS2_SALNS 30S ribosomal protein S2 OS=Salmonella newport (strain SL254) GN=rpsB PE=3 SV=1 146 359 3.0E-28
sp|B4TK44|RS2_SALHS 30S ribosomal protein S2 OS=Salmonella heidelberg (strain SL476) GN=rpsB PE=3 SV=1 146 359 3.0E-28
sp|B5RHF4|RS2_SALG2 30S ribosomal protein S2 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rpsB PE=3 SV=1 146 359 3.0E-28
sp|B5R3I2|RS2_SALEP 30S ribosomal protein S2 OS=Salmonella enteritidis PT4 (strain P125109) GN=rpsB PE=3 SV=1 146 359 3.0E-28
sp|B5FJ16|RS2_SALDC 30S ribosomal protein S2 OS=Salmonella dublin (strain CT_02021853) GN=rpsB PE=3 SV=1 146 359 3.0E-28
sp|A9MPJ3|RS2_SALAR 30S ribosomal protein S2 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rpsB PE=3 SV=1 146 359 3.0E-28
sp|B5F8T0|RS2_SALA4 30S ribosomal protein S2 OS=Salmonella agona (strain SL483) GN=rpsB PE=3 SV=1 146 359 3.0E-28
sp|Q5N1Q0|RS2_SYNP6 30S ribosomal protein S2 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rpsB PE=3 SV=1 146 360 3.0E-28
sp|Q31K59|RS2_SYNE7 30S ribosomal protein S2 OS=Synechococcus elongatus (strain PCC 7942) GN=rpsB PE=3 SV=1 146 360 3.0E-28
sp|Q3AXI9|RS2_SYNS9 30S ribosomal protein S2 OS=Synechococcus sp. (strain CC9902) GN=rpsB PE=3 SV=1 146 347 3.0E-28
sp|Q57T39|RS2_SALCH 30S ribosomal protein S2 OS=Salmonella choleraesuis (strain SC-B67) GN=rpsB PE=3 SV=1 146 359 3.0E-28
sp|B5Y1K2|RS2_KLEP3 30S ribosomal protein S2 OS=Klebsiella pneumoniae (strain 342) GN=rpsB PE=3 SV=1 146 359 3.0E-28
sp|A5WCX2|RS2_PSYWF 30S ribosomal protein S2 OS=Psychrobacter sp. (strain PRwf-1) GN=rpsB PE=3 SV=2 143 348 3.0E-28
sp|Q7V7Z4|RS2_PROMM 30S ribosomal protein S2 OS=Prochlorococcus marinus (strain MIT 9313) GN=rpsB PE=3 SV=1 146 350 3.0E-28
sp|A5D2T5|RS2_PELTS 30S ribosomal protein S2 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rpsB PE=3 SV=1 146 347 3.0E-28
sp|Q3BVK3|RS2_XANC5 30S ribosomal protein S2 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rpsB PE=3 SV=1 146 347 3.0E-28
sp|A1E9R7|RR2_SORBI 30S ribosomal protein S2, chloroplastic OS=Sorghum bicolor GN=rps2 PE=3 SV=1 145 353 3.0E-28
sp|Q6ENX0|RR2_SACOF 30S ribosomal protein S2, chloroplastic OS=Saccharum officinarum GN=rps2 PE=3 SV=1 145 353 3.0E-28
sp|Q6L3A4|RR2_SACHY 30S ribosomal protein S2, chloroplastic OS=Saccharum hybrid GN=rps2 PE=3 SV=1 145 353 3.0E-28
sp|B4SQ23|RS2_STRM5 30S ribosomal protein S2 OS=Stenotrophomonas maltophilia (strain R551-3) GN=rpsB PE=3 SV=1 146 347 3.0E-28
sp|A1JP82|RS2_YERE8 30S ribosomal protein S2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rpsB PE=3 SV=1 146 358 3.0E-28
sp|A8SE74|RR2_CERDE 30S ribosomal protein S2, chloroplastic OS=Ceratophyllum demersum GN=rps2 PE=3 SV=1 145 353 3.0E-28
sp|Q8PMK5|RS2_XANAC 30S ribosomal protein S2 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rpsB PE=3 SV=1 146 347 3.0E-28
sp|Q3SKN9|RS2_THIDA 30S ribosomal protein S2 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rpsB PE=3 SV=1 146 353 4.0E-28
sp|Q1QMN7|RS2_NITHX 30S ribosomal protein S2 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rpsB PE=3 SV=1 145 346 4.0E-28
sp|A8Y9G3|RR2_LOLPR 30S ribosomal protein S2, chloroplastic OS=Lolium perenne GN=rps2 PE=3 SV=1 145 353 4.0E-28
sp|A4W6R4|RS2_ENT38 30S ribosomal protein S2 OS=Enterobacter sp. (strain 638) GN=rpsB PE=3 SV=1 146 358 4.0E-28
sp|B2KC76|RS2_ELUMP 30S ribosomal protein S2 OS=Elusimicrobium minutum (strain Pei191) GN=rpsB PE=3 SV=1 145 349 4.0E-28
sp|A1K6S1|RS2_AZOSB 30S ribosomal protein S2 OS=Azoarcus sp. (strain BH72) GN=rpsB PE=3 SV=1 146 353 4.0E-28
sp|C4LJA9|RS2_CORK4 30S ribosomal protein S2 OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=rpsB PE=3 SV=1 146 347 4.0E-28
sp|B2G6U1|RS2_LACRJ 30S ribosomal protein S2 OS=Lactobacillus reuteri (strain JCM 1112) GN=rpsB PE=3 SV=1 146 358 4.0E-28
sp|A5VJC5|RS2_LACRD 30S ribosomal protein S2 OS=Lactobacillus reuteri (strain DSM 20016) GN=rpsB PE=3 SV=1 146 358 4.0E-28
sp|A4QKI1|RR2_CAPBU 30S ribosomal protein S2, chloroplastic OS=Capsella bursa-pastoris GN=rps2 PE=3 SV=1 145 354 4.0E-28
sp|Q1WUL5|RS2_LACS1 30S ribosomal protein S2 OS=Lactobacillus salivarius (strain UCC118) GN=rpsB PE=3 SV=1 146 348 5.0E-28
sp|Q0AYK4|RS2_SYNWW 30S ribosomal protein S2 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rpsB PE=3 SV=2 146 347 5.0E-28
sp|Q7U795|RS2_SYNPX 30S ribosomal protein S2 OS=Synechococcus sp. (strain WH8102) GN=rpsB PE=3 SV=1 146 347 5.0E-28
sp|A2CA98|RS2_PROM3 30S ribosomal protein S2 OS=Prochlorococcus marinus (strain MIT 9303) GN=rpsB PE=3 SV=1 146 347 5.0E-28
sp|B2J6U9|RS2_NOSP7 30S ribosomal protein S2 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=rpsB PE=3 SV=1 146 351 5.0E-28
sp|A9KNC4|RS2_CLOPH 30S ribosomal protein S2 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=rpsB PE=3 SV=1 146 342 5.0E-28
sp|A4QLS2|RR2_NASOF 30S ribosomal protein S2, chloroplastic OS=Nasturtium officinale GN=rps2 PE=3 SV=1 145 354 5.0E-28
sp|A4QKS0|RR2_CRUWA 30S ribosomal protein S2, chloroplastic OS=Crucihimalaya wallichii GN=rps2 PE=3 SV=1 145 354 5.0E-28
sp|A4QK07|RR2_ARAHI 30S ribosomal protein S2, chloroplastic OS=Arabis hirsuta GN=rps2 PE=3 SV=1 145 354 5.0E-28
sp|C3K5E6|RS2_PSEFS 30S ribosomal protein S2 OS=Pseudomonas fluorescens (strain SBW25) GN=rpsB PE=3 SV=1 146 349 6.0E-28
sp|Q215E9|RS2_RHOPB 30S ribosomal protein S2 OS=Rhodopseudomonas palustris (strain BisB18) GN=rpsB PE=3 SV=1 143 342 6.0E-28
sp|B0THD7|RS2_HELMI 30S ribosomal protein S2 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rpsB PE=3 SV=1 146 342 6.0E-28
sp|O78482|RR2_GUITH 30S ribosomal protein S2, chloroplastic OS=Guillardia theta GN=rps2 PE=3 SV=1 146 349 6.0E-28
sp|B9JEX0|RS2_AGRRK 30S ribosomal protein S2 OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=rpsB PE=3 SV=1 145 346 6.0E-28
sp|Q8Y6M6|RS2_LISMO 30S ribosomal protein S2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rpsB PE=3 SV=1 146 342 6.0E-28
sp|B8DFR3|RS2_LISMH 30S ribosomal protein S2 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=rpsB PE=3 SV=1 146 342 6.0E-28
sp|Q71Z11|RS2_LISMF 30S ribosomal protein S2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rpsB PE=3 SV=1 146 342 6.0E-28
sp|C1KVV4|RS2_LISMC 30S ribosomal protein S2 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rpsB PE=3 SV=1 146 342 6.0E-28
sp|Q4VZP4|RR2_CUCSA 30S ribosomal protein S2, chloroplastic OS=Cucumis sativus GN=rps2 PE=3 SV=1 145 354 7.0E-28
sp|Q3A395|RS2_PELCD 30S ribosomal protein S2 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rpsB PE=3 SV=1 146 355 7.0E-28
sp|Q03MW7|RS2_STRTD 30S ribosomal protein S2 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rpsB PE=3 SV=1 146 348 7.0E-28
sp|Q8YMY2|RS2_NOSS1 30S ribosomal protein S2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rpsB PE=3 SV=1 146 351 7.0E-28
sp|B1XXJ5|RS2_LEPCP 30S ribosomal protein S2 OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=rpsB PE=3 SV=1 147 358 7.0E-28
sp|Q2GCI4|RS2_NEOSM 30S ribosomal protein S2 OS=Neorickettsia sennetsu (strain Miyayama) GN=rpsB PE=3 SV=1 146 352 7.0E-28
sp|A0AJB1|RS2_LISW6 30S ribosomal protein S2 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rpsB PE=3 SV=1 146 342 7.0E-28
sp|Q92B01|RS2_LISIN 30S ribosomal protein S2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rpsB PE=3 SV=1 146 342 7.0E-28
sp|A3DE59|RS2_CLOTH 30S ribosomal protein S2 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rpsB PE=3 SV=1 146 365 7.0E-28
sp|C0QB17|RS2_DESAH 30S ribosomal protein S2 OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=rpsB PE=3 SV=1 146 358 7.0E-28
sp|A4QJI8|RR2_AETGR 30S ribosomal protein S2, chloroplastic OS=Aethionema grandiflorum GN=rps2 PE=3 SV=1 145 354 7.0E-28
sp|Q3MBF3|RS2_ANAVT 30S ribosomal protein S2 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rpsB PE=3 SV=1 146 351 7.0E-28
sp|B0RW65|RS2_XANCB 30S ribosomal protein S2 OS=Xanthomonas campestris pv. campestris (strain B100) GN=rpsB PE=3 SV=1 146 347 8.0E-28
sp|Q4USR2|RS2_XANC8 30S ribosomal protein S2 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpsB PE=3 SV=1 146 347 8.0E-28
sp|Q2G8L0|RS2_NOVAD 30S ribosomal protein S2 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rpsB PE=3 SV=1 146 355 8.0E-28
sp|A8ALC1|RS2_CITK8 30S ribosomal protein S2 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rpsB PE=3 SV=1 146 359 8.0E-28
sp|Q3JZ54|RS2_STRA1 30S ribosomal protein S2 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rpsB PE=3 SV=1 146 348 8.0E-28
sp|Q9X5U8|RS2_COXBU 30S ribosomal protein S2 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rpsB PE=3 SV=1 145 332 8.0E-28
sp|A9N8R0|RS2_COXBR 30S ribosomal protein S2 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rpsB PE=3 SV=1 145 332 8.0E-28
sp|A9KBR3|RS2_COXBN 30S ribosomal protein S2 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rpsB PE=3 SV=1 145 332 8.0E-28
sp|Q8YHH6|RS2_BRUME 30S ribosomal protein S2 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rpsB PE=3 SV=2 145 346 8.0E-28
sp|B5F9X6|RS2_VIBFM 30S ribosomal protein S2 OS=Vibrio fischeri (strain MJ11) GN=rpsB PE=3 SV=1 146 356 8.0E-28
sp|Q5E3D9|RS2_VIBF1 30S ribosomal protein S2 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rpsB PE=3 SV=1 146 356 8.0E-28
sp|A7ZF28|RS2_CAMC1 30S ribosomal protein S2 OS=Campylobacter concisus (strain 13826) GN=rpsB PE=3 SV=1 146 347 8.0E-28
sp|Q0BSM5|RS2_GRABC 30S ribosomal protein S2 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rpsB PE=3 SV=1 141 342 8.0E-28
sp|Q89KP3|RS2_BRADU 30S ribosomal protein S2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rpsB PE=3 SV=1 145 346 8.0E-28
sp|Q46LH9|RS2_PROMT 30S ribosomal protein S2 OS=Prochlorococcus marinus (strain NATL2A) GN=rpsB PE=3 SV=2 146 347 8.0E-28
sp|A2C1I7|RS2_PROM1 30S ribosomal protein S2 OS=Prochlorococcus marinus (strain NATL1A) GN=rpsB PE=3 SV=2 146 347 8.0E-28
sp|A4QL08|RR2_DRANE 30S ribosomal protein S2, chloroplastic OS=Draba nemorosa GN=rps2 PE=3 SV=1 145 353 9.0E-28
sp|Q6EW59|RR2_NYMAL 30S ribosomal protein S2, chloroplastic OS=Nymphaea alba GN=rps2 PE=3 SV=1 145 353 1.0E-27
sp|Q5M6G5|RS2_STRT2 30S ribosomal protein S2 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rpsB PE=3 SV=1 146 355 1.0E-27
sp|Q5M1X5|RS2_STRT1 30S ribosomal protein S2 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rpsB PE=3 SV=1 146 355 1.0E-27
sp|Q8DXL8|RS2_STRA5 30S ribosomal protein S2 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rpsB PE=3 SV=1 146 348 1.0E-27
sp|Q8E388|RS2_STRA3 30S ribosomal protein S2 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rpsB PE=3 SV=1 146 348 1.0E-27
sp|Q8PAV2|RS2_XANCP 30S ribosomal protein S2 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpsB PE=3 SV=1 146 347 1.0E-27
sp|Q1QDT1|RS2_PSYCK 30S ribosomal protein S2 OS=Psychrobacter cryohalolentis (strain K5) GN=rpsB PE=3 SV=1 143 348 1.0E-27
sp|Q4FUT9|RS2_PSYA2 30S ribosomal protein S2 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rpsB PE=3 SV=1 143 348 1.0E-27
sp|Q4FG66|RR2_NUPAD 30S ribosomal protein S2, chloroplastic OS=Nuphar advena GN=rps2 PE=3 SV=1 145 347 1.0E-27
sp|Q60BB0|RS2_METCA 30S ribosomal protein S2 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rpsB PE=3 SV=1 146 347 1.0E-27
sp|Q3KHB2|RS2_PSEPF 30S ribosomal protein S2 OS=Pseudomonas fluorescens (strain Pf0-1) GN=rpsB PE=3 SV=1 146 349 1.0E-27
sp|A0PQ79|RS2_MYCUA 30S ribosomal protein S2 OS=Mycobacterium ulcerans (strain Agy99) GN=rpsB PE=3 SV=2 146 350 1.0E-27
sp|Q4KHH6|RS2_PSEF5 30S ribosomal protein S2 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rpsB PE=3 SV=1 146 349 1.0E-27
sp|B1YI76|RS2_EXIS2 30S ribosomal protein S2 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rpsB PE=3 SV=1 146 342 1.0E-27
sp|Q47F92|RS2_DECAR 30S ribosomal protein S2 OS=Dechloromonas aromatica (strain RCB) GN=rpsB PE=3 SV=1 146 353 1.0E-27
sp|Q1MRE3|RS2_LAWIP 30S ribosomal protein S2 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=rpsB PE=3 SV=1 146 347 1.0E-27
sp|Q3SRH2|RS2_NITWN 30S ribosomal protein S2 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rpsB PE=3 SV=1 145 346 1.0E-27
sp|Q2S6J0|RS2_SALRD 30S ribosomal protein S2 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=rpsB PE=3 SV=2 146 350 1.0E-27
sp|A4X4J2|RS2_SALTO 30S ribosomal protein S2 OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=rpsB PE=3 SV=1 146 350 1.0E-27
sp|Q56P10|RR2_LACSA 30S ribosomal protein S2, chloroplastic OS=Lactuca sativa GN=rps2 PE=3 SV=1 145 353 1.0E-27
sp|Q1KXW9|RR2_HELAN 30S ribosomal protein S2, chloroplastic OS=Helianthus annuus GN=rps2 PE=3 SV=1 145 353 1.0E-27
sp|A4QL95|RR2_LEPVR 30S ribosomal protein S2, chloroplastic OS=Lepidium virginicum GN=rps2 PE=3 SV=1 145 354 1.0E-27
sp|Q88VJ4|RS2_LACPL 30S ribosomal protein S2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpsB PE=3 SV=1 146 353 1.0E-27
sp|B0S184|RS2_FINM2 30S ribosomal protein S2 OS=Finegoldia magna (strain ATCC 29328) GN=rpsB PE=3 SV=1 146 342 1.0E-27
sp|C6E512|RS2_GEOSM 30S ribosomal protein S2 OS=Geobacter sp. (strain M21) GN=rpsB PE=3 SV=1 145 355 1.0E-27
sp|Q9BBS6|RR2_LOTJA 30S ribosomal protein S2, chloroplastic OS=Lotus japonicus GN=rps2 PE=3 SV=1 145 353 1.0E-27
sp|A8W3H9|RR2_CUSOB Plastid 30S ribosomal protein S2 OS=Cuscuta obtusiflora GN=rps2 PE=3 SV=1 145 353 1.0E-27
sp|A6LHM7|RS2_PARD8 30S ribosomal protein S2 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=rpsB PE=3 SV=1 146 369 1.0E-27
sp|Q98MB2|RS2_RHILO 30S ribosomal protein S2 OS=Rhizobium loti (strain MAFF303099) GN=rpsB PE=3 SV=1 145 346 1.0E-27
sp|A4QJA4|RR2_AETCO 30S ribosomal protein S2, chloroplastic OS=Aethionema cordifolium GN=rps2 PE=3 SV=1 145 354 1.0E-27
sp|Q2W4C3|RS2_MAGSA 30S ribosomal protein S2 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rpsB PE=3 SV=1 147 342 1.0E-27
sp|A1WX21|RS2_HALHL 30S ribosomal protein S2 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rpsB PE=3 SV=1 145 357 1.0E-27
sp|B2A380|RS2_NATTJ 30S ribosomal protein S2 OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rpsB PE=3 SV=1 146 347 1.0E-27
sp|A5EK55|RS2_BRASB 30S ribosomal protein S2 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rpsB PE=3 SV=1 141 346 1.0E-27
sp|Q73VQ7|RS2_MYCPA 30S ribosomal protein S2 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=rpsB PE=3 SV=1 146 350 2.0E-27
sp|A8M6B1|RS2_SALAI 30S ribosomal protein S2 OS=Salinispora arenicola (strain CNS-205) GN=rpsB PE=3 SV=1 146 350 2.0E-27
sp|Q8CWM8|RS2_STRR6 30S ribosomal protein S2 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpsB PE=3 SV=1 146 348 2.0E-27
sp|Q04HW3|RS2_STRP2 30S ribosomal protein S2 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpsB PE=3 SV=1 146 348 2.0E-27
sp|B0Z546|RR2_OENGL 30S ribosomal protein S2, chloroplastic OS=Oenothera glazioviana GN=rps2 PE=3 SV=1 145 353 2.0E-27
sp|Q9MTM2|RR2_OENEH 30S ribosomal protein S2, chloroplastic OS=Oenothera elata subsp. hookeri GN=rps2 PE=3 SV=2 145 353 2.0E-27
sp|B0Z4W2|RR2_OENBI 30S ribosomal protein S2, chloroplastic OS=Oenothera biennis GN=rps2 PE=3 SV=1 145 353 2.0E-27
sp|A7MGT2|RS2_CROS8 30S ribosomal protein S2 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rpsB PE=3 SV=1 146 359 2.0E-27
sp|Q5QXS0|RS2_IDILO 30S ribosomal protein S2 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rpsB PE=3 SV=1 145 342 2.0E-27
sp|Q47S53|RS2_THEFY 30S ribosomal protein S2 OS=Thermobifida fusca (strain YX) GN=rpsB PE=3 SV=1 146 346 2.0E-27
sp|Q6MGY6|RS2_BDEBA 30S ribosomal protein S2 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=rpsB PE=3 SV=1 146 346 2.0E-27
sp|A4YVG6|RS2_BRASO 30S ribosomal protein S2 OS=Bradyrhizobium sp. (strain ORS278) GN=rpsB PE=3 SV=1 141 346 2.0E-27
sp|Q82TZ6|RS2_NITEU 30S ribosomal protein S2 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rpsB PE=3 SV=1 146 358 2.0E-27
sp|C1CUD2|RS2_STRZT 30S ribosomal protein S2 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rpsB PE=3 SV=1 146 348 2.0E-27
sp|C1CNI8|RS2_STRZP 30S ribosomal protein S2 OS=Streptococcus pneumoniae (strain P1031) GN=rpsB PE=3 SV=1 146 348 2.0E-27
sp|C1CHL4|RS2_STRZJ 30S ribosomal protein S2 OS=Streptococcus pneumoniae (strain JJA) GN=rpsB PE=3 SV=1 146 348 2.0E-27
sp|B8ZQA6|RS2_STRPJ 30S ribosomal protein S2 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rpsB PE=3 SV=1 146 348 2.0E-27
sp|C1CBJ2|RS2_STRP7 30S ribosomal protein S2 OS=Streptococcus pneumoniae (strain 70585) GN=rpsB PE=3 SV=1 146 348 2.0E-27
sp|B5E3W1|RS2_STRP4 30S ribosomal protein S2 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rpsB PE=3 SV=1 146 348 2.0E-27
sp|Q73K75|RS2_TREDE 30S ribosomal protein S2 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rpsB PE=3 SV=1 146 342 2.0E-27
sp|A3QGA3|RS2_SHELP 30S ribosomal protein S2 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rpsB PE=3 SV=1 146 356 2.0E-27
sp|Q02AL1|RS2_SOLUE 30S ribosomal protein S2 OS=Solibacter usitatus (strain Ellin6076) GN=rpsB PE=3 SV=1 146 347 2.0E-27
sp|Q7N8P7|RS2_PHOLL 30S ribosomal protein S2 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rpsB PE=3 SV=1 146 358 2.0E-27
sp|A6T4X1|RS2_KLEP7 30S ribosomal protein S2 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rpsB PE=3 SV=2 146 359 2.0E-27
sp|Q09X28|RR2_MORIN 30S ribosomal protein S2, chloroplastic OS=Morus indica GN=rps2 PE=3 SV=1 145 354 2.0E-27
sp|B4F2D3|RS2_PROMH 30S ribosomal protein S2 OS=Proteus mirabilis (strain HI4320) GN=rpsB PE=3 SV=1 146 356 2.0E-27
sp|Q97N56|RS2_STRPN 30S ribosomal protein S2 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpsB PE=3 SV=1 146 348 2.0E-27
sp|B0K1P9|RS2_THEPX 30S ribosomal protein S2 OS=Thermoanaerobacter sp. (strain X514) GN=rpsB PE=3 SV=1 146 342 2.0E-27
sp|B0K9R6|RS2_THEP3 30S ribosomal protein S2 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpsB PE=3 SV=1 146 342 2.0E-27
sp|B2INN2|RS2_STRPS 30S ribosomal protein S2 OS=Streptococcus pneumoniae (strain CGSP14) GN=rpsB PE=3 SV=2 146 348 2.0E-27
sp|B5EHW1|RS2_GEOBB 30S ribosomal protein S2 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=rpsB PE=3 SV=1 145 355 2.0E-27
sp|Q5WFS8|RS2_BACSK 30S ribosomal protein S2 OS=Bacillus clausii (strain KSM-K16) GN=rpsB PE=3 SV=1 146 342 2.0E-27
sp|C5BQF6|RS2_TERTT 30S ribosomal protein S2 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=rpsB PE=3 SV=1 146 346 2.0E-27
sp|Q136A4|RS2_RHOPS 30S ribosomal protein S2 OS=Rhodopseudomonas palustris (strain BisB5) GN=rpsB PE=3 SV=1 143 342 2.0E-27
sp|A4WSP0|RS2_RHOS5 30S ribosomal protein S2 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rpsB PE=3 SV=2 145 346 2.0E-27
sp|A6MVX1|RR2_RHDSA 30S ribosomal protein S2, chloroplastic OS=Rhodomonas salina GN=rps2 PE=3 SV=1 146 348 2.0E-27
sp|Q5LRZ4|RS2_RUEPO 30S ribosomal protein S2 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rpsB PE=3 SV=1 145 354 2.0E-27
sp|A1W918|RS2_ACISJ 30S ribosomal protein S2 OS=Acidovorax sp. (strain JS42) GN=rpsB PE=3 SV=1 146 357 2.0E-27
sp|P35014|RR2_GALSU 30S ribosomal protein S2, chloroplastic OS=Galdieria sulphuraria GN=rps2 PE=3 SV=1 146 350 3.0E-27
sp|B1IAC8|RS2_STRPI 30S ribosomal protein S2 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rpsB PE=3 SV=1 146 348 3.0E-27
sp|C3LQ32|RS2_VIBCM 30S ribosomal protein S2 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rpsB PE=3 SV=1 146 356 3.0E-27
sp|Q9KPV2|RS2_VIBCH 30S ribosomal protein S2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rpsB PE=3 SV=1 146 356 3.0E-27
sp|A5F607|RS2_VIBC3 30S ribosomal protein S2 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rpsB PE=3 SV=1 146 356 3.0E-27
sp|B8J3M5|RS2_DESDA 30S ribosomal protein S2 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=rpsB PE=3 SV=1 146 347 3.0E-27
sp|Q7MX41|RS2_PORGI 30S ribosomal protein S2 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=rpsB PE=3 SV=1 146 346 3.0E-27
sp|B2RL62|RS2_PORG3 30S ribosomal protein S2 OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=rpsB PE=3 SV=1 146 346 3.0E-27
sp|Q32JU0|RS2_SHIDS 30S ribosomal protein S2 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rpsB PE=3 SV=1 146 358 3.0E-27
sp|B7LWA8|RS2_ESCF3 30S ribosomal protein S2 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rpsB PE=3 SV=1 146 358 3.0E-27
sp|Q1RG21|RS2_ECOUT 30S ribosomal protein S2 OS=Escherichia coli (strain UTI89 / UPEC) GN=rpsB PE=3 SV=2 146 358 3.0E-27
sp|B1LGX0|RS2_ECOSM 30S ribosomal protein S2 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rpsB PE=3 SV=1 146 358 3.0E-27
sp|B7N836|RS2_ECOLU 30S ribosomal protein S2 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rpsB PE=3 SV=1 146 358 3.0E-27
sp|P0A7V0|RS2_ECOLI 30S ribosomal protein S2 OS=Escherichia coli (strain K12) GN=rpsB PE=1 SV=2 146 358 3.0E-27
sp|B1IQH2|RS2_ECOLC 30S ribosomal protein S2 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rpsB PE=3 SV=1 146 358 3.0E-27
sp|P0A7V1|RS2_ECOL6 30S ribosomal protein S2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rpsB PE=3 SV=2 146 358 3.0E-27
sp|Q0TLG4|RS2_ECOL5 30S ribosomal protein S2 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rpsB PE=3 SV=1 146 358 3.0E-27
sp|A1A7L3|RS2_ECOK1 30S ribosomal protein S2 OS=Escherichia coli O1:K1 / APEC GN=rpsB PE=3 SV=1 146 358 3.0E-27
sp|B1XD38|RS2_ECODH 30S ribosomal protein S2 OS=Escherichia coli (strain K12 / DH10B) GN=rpsB PE=3 SV=1 146 358 3.0E-27
sp|C4ZRR1|RS2_ECOBW 30S ribosomal protein S2 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rpsB PE=3 SV=1 146 358 3.0E-27
sp|B7MP29|RS2_ECO81 30S ribosomal protein S2 OS=Escherichia coli O81 (strain ED1a) GN=rpsB PE=3 SV=1 146 358 3.0E-27
sp|B7NID0|RS2_ECO7I 30S ribosomal protein S2 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rpsB PE=3 SV=1 146 358 3.0E-27
sp|B5Z0E7|RS2_ECO5E 30S ribosomal protein S2 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rpsB PE=3 SV=1 146 358 3.0E-27
sp|P0A7V2|RS2_ECO57 30S ribosomal protein S2 OS=Escherichia coli O157:H7 GN=rpsB PE=3 SV=2 146 358 3.0E-27
sp|B7MBF0|RS2_ECO45 30S ribosomal protein S2 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rpsB PE=3 SV=1 146 358 3.0E-27
sp|B7UIL4|RS2_ECO27 30S ribosomal protein S2 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rpsB PE=3 SV=1 146 358 3.0E-27
sp|Q68S17|RR2_PANGI 30S ribosomal protein S2, chloroplastic OS=Panax ginseng GN=rps2 PE=3 SV=1 145 353 3.0E-27
sp|P9WH39|RS2_MYCTU 30S ribosomal protein S2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=rpsB PE=1 SV=1 146 350 3.0E-27
sp|P9WH38|RS2_MYCTO 30S ribosomal protein S2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rpsB PE=3 SV=1 146 350 3.0E-27
sp|P66538|RS2_MYCBO 30S ribosomal protein S2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=rpsB PE=3 SV=1 146 350 3.0E-27
sp|Q3Z5I9|RS2_SHISS 30S ribosomal protein S2 OS=Shigella sonnei (strain Ss046) GN=rpsB PE=3 SV=1 146 358 3.0E-27
sp|Q325X1|RS2_SHIBS 30S ribosomal protein S2 OS=Shigella boydii serotype 4 (strain Sb227) GN=rpsB PE=3 SV=1 146 358 3.0E-27
sp|B2U311|RS2_SHIB3 30S ribosomal protein S2 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rpsB PE=3 SV=1 146 358 3.0E-27
sp|B6HZE3|RS2_ECOSE 30S ribosomal protein S2 OS=Escherichia coli (strain SE11) GN=rpsB PE=3 SV=1 146 358 3.0E-27
sp|A7ZWB5|RS2_ECOHS 30S ribosomal protein S2 OS=Escherichia coli O9:H4 (strain HS) GN=rpsB PE=3 SV=1 146 358 3.0E-27
sp|B7M1A9|RS2_ECO8A 30S ribosomal protein S2 OS=Escherichia coli O8 (strain IAI1) GN=rpsB PE=3 SV=1 146 358 3.0E-27
sp|B7LGN0|RS2_ECO55 30S ribosomal protein S2 OS=Escherichia coli (strain 55989 / EAEC) GN=rpsB PE=3 SV=1 146 358 3.0E-27
sp|A7ZHQ9|RS2_ECO24 30S ribosomal protein S2 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rpsB PE=3 SV=1 146 358 3.0E-27
sp|A7I1L3|RS2_CAMHC 30S ribosomal protein S2 OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=rpsB PE=3 SV=1 146 357 3.0E-27
sp|A3PJM7|RS2_RHOS1 30S ribosomal protein S2 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rpsB PE=3 SV=1 145 346 3.0E-27
sp|O33038|RS2_MYCLE 30S ribosomal protein S2 OS=Mycobacterium leprae (strain TN) GN=rpsB PE=3 SV=1 146 346 3.0E-27
sp|B1H053|RS2_UNCTG 30S ribosomal protein S2 OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=rpsB PE=3 SV=1 145 355 3.0E-27
sp|B8I6D2|RS2_CLOCE 30S ribosomal protein S2 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=rpsB PE=3 SV=1 146 347 3.0E-27
sp|B9KSF0|RS2_RHOSK 30S ribosomal protein S2 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=rpsB PE=3 SV=1 145 346 3.0E-27
sp|Q3J2N4|RS2_RHOS4 30S ribosomal protein S2 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rpsB PE=3 SV=1 145 346 3.0E-27
sp|Q48F59|RS2_PSE14 30S ribosomal protein S2 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rpsB PE=3 SV=1 146 349 3.0E-27
sp|Q8XZJ1|RS2_RALSO 30S ribosomal protein S2 OS=Ralstonia solanacearum (strain GMI1000) GN=rpsB PE=3 SV=1 146 357 3.0E-27
sp|Q6F0Q4|RS2_MESFL 30S ribosomal protein S2 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rpsB PE=3 SV=2 144 351 4.0E-27
sp|B1I2K0|RS2_DESAP 30S ribosomal protein S2 OS=Desulforudis audaxviator (strain MP104C) GN=rpsB PE=3 SV=1 146 347 4.0E-27
sp|B9MGL7|RS2_ACIET 30S ribosomal protein S2 OS=Acidovorax ebreus (strain TPSY) GN=rpsB PE=3 SV=1 146 357 4.0E-27
sp|Q886P3|RS2_PSESM 30S ribosomal protein S2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rpsB PE=3 SV=1 146 349 4.0E-27
sp|Q9X5E7|RS2_ZYMMO 30S ribosomal protein S2 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rpsB PE=3 SV=1 146 353 4.0E-27
sp|B1KNU3|RS2_SHEWM 30S ribosomal protein S2 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rpsB PE=3 SV=1 146 356 4.0E-27
sp|A1TN69|RS2_ACIAC 30S ribosomal protein S2 OS=Acidovorax citrulli (strain AAC00-1) GN=rpsB PE=3 SV=1 146 365 4.0E-27
sp|Q2IW80|RS2_RHOP2 30S ribosomal protein S2 OS=Rhodopseudomonas palustris (strain HaA2) GN=rpsB PE=3 SV=1 145 342 4.0E-27
sp|Q38W64|RS2_LACSS 30S ribosomal protein S2 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rpsB PE=3 SV=1 146 348 5.0E-27
sp|Q1GRQ0|RS2_SPHAL 30S ribosomal protein S2 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rpsB PE=3 SV=1 146 349 5.0E-27
sp|Q4ZWS8|RS2_PSEU2 30S ribosomal protein S2 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rpsB PE=3 SV=1 146 349 5.0E-27
sp|A0QVB8|RS2_MYCS2 30S ribosomal protein S2 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rpsB PE=3 SV=2 146 358 5.0E-27
sp|Q28PY9|RS2_JANSC 30S ribosomal protein S2 OS=Jannaschia sp. (strain CCS1) GN=rpsB PE=3 SV=1 141 354 5.0E-27
sp|A4QK94|RR2_BARVE 30S ribosomal protein S2, chloroplastic OS=Barbarea verna GN=rps2 PE=3 SV=1 145 354 5.0E-27
sp|A8FY42|RS2_SHESH 30S ribosomal protein S2 OS=Shewanella sediminis (strain HAW-EB3) GN=rpsB PE=3 SV=1 146 356 5.0E-27
sp|Q12NY7|RS2_SHEDO 30S ribosomal protein S2 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rpsB PE=3 SV=1 146 356 5.0E-27
sp|A6MMB1|RR2_CHLSC 30S ribosomal protein S2, chloroplastic OS=Chloranthus spicatus GN=rps2 PE=3 SV=1 145 353 5.0E-27
sp|Q5F5F3|RS2_NEIG1 30S ribosomal protein S2 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rpsB PE=3 SV=1 146 353 5.0E-27
sp|A9L985|RR2_LEMMI 30S ribosomal protein S2, chloroplastic OS=Lemna minor GN=rps2 PE=3 SV=1 145 353 5.0E-27
sp|A6VUS2|RS2_MARMS 30S ribosomal protein S2 OS=Marinomonas sp. (strain MWYL1) GN=rpsB PE=3 SV=1 146 348 6.0E-27
sp|B9M5C6|RS2_GEODF 30S ribosomal protein S2 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=rpsB PE=3 SV=1 145 358 6.0E-27
sp|Q0G9N0|RR2_LIRTU 30S ribosomal protein S2, chloroplastic OS=Liriodendron tulipifera GN=rps2 PE=3 SV=1 145 353 6.0E-27
sp|Q085E2|RS2_SHEFN 30S ribosomal protein S2 OS=Shewanella frigidimarina (strain NCIMB 400) GN=rpsB PE=3 SV=1 146 356 6.0E-27
sp|Q6D8E3|RS2_PECAS 30S ribosomal protein S2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rpsB PE=3 SV=1 146 356 6.0E-27
sp|Q2YBA7|RS2_NITMU 30S ribosomal protein S2 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rpsB PE=3 SV=2 146 358 6.0E-27
sp|C4K5W9|RS2_HAMD5 30S ribosomal protein S2 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rpsB PE=3 SV=1 146 349 6.0E-27
sp|P0C482|RR2_ORYSJ 30S ribosomal protein S2, chloroplastic OS=Oryza sativa subsp. japonica GN=rps2 PE=3 SV=1 145 353 6.0E-27
sp|P0C481|RR2_ORYSI 30S ribosomal protein S2, chloroplastic OS=Oryza sativa subsp. indica GN=rps2 PE=3 SV=1 145 353 6.0E-27
sp|P0C480|RR2_ORYSA 30S ribosomal protein S2, chloroplastic OS=Oryza sativa GN=rps2 PE=3 SV=1 145 353 6.0E-27
sp|Q49L09|RR2_EUCGG 30S ribosomal protein S2, chloroplastic OS=Eucalyptus globulus subsp. globulus GN=rps2 PE=3 SV=1 145 353 7.0E-27
sp|A5G7W8|RS2_GEOUR 30S ribosomal protein S2 OS=Geobacter uraniireducens (strain Rf4) GN=rpsB PE=3 SV=1 145 350 7.0E-27
sp|B0Z5D0|RR2_OENPA 30S ribosomal protein S2, chloroplastic OS=Oenothera parviflora GN=rps2 PE=3 SV=1 145 353 7.0E-27
sp|B0Z4M8|RR2_OENAR 30S ribosomal protein S2, chloroplastic OS=Oenothera argillicola GN=rps2 PE=3 SV=1 145 353 7.0E-27
sp|A7H2J2|RS2_CAMJD 30S ribosomal protein S2 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=rpsB PE=3 SV=1 146 376 7.0E-27
sp|Q2NRK7|RS2_SODGM 30S ribosomal protein S2 OS=Sodalis glossinidius (strain morsitans) GN=rpsB PE=3 SV=1 146 359 7.0E-27
sp|C6DAI3|RS2_PECCP 30S ribosomal protein S2 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rpsB PE=3 SV=1 146 356 7.0E-27
sp|A8I460|RS2_AZOC5 30S ribosomal protein S2 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rpsB PE=3 SV=1 145 346 7.0E-27
sp|Q83SL4|RS2_SHIFL 30S ribosomal protein S2 OS=Shigella flexneri GN=rpsB PE=3 SV=4 146 358 7.0E-27
sp|Q0T840|RS2_SHIF8 30S ribosomal protein S2 OS=Shigella flexneri serotype 5b (strain 8401) GN=rpsB PE=3 SV=2 146 358 7.0E-27
sp|Q2SSA8|RS2_MYCCT 30S ribosomal protein S2 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=rpsB PE=3 SV=1 145 369 7.0E-27
sp|C4L864|RS2_TOLAT 30S ribosomal protein S2 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rpsB PE=3 SV=1 146 332 8.0E-27
sp|B2GBL8|RS2_LACF3 30S ribosomal protein S2 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=rpsB PE=3 SV=1 146 368 8.0E-27
sp|C4L650|RS2_EXISA 30S ribosomal protein S2 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=rpsB PE=3 SV=1 146 342 8.0E-27
sp|A4QF32|RS2_CORGB 30S ribosomal protein S2 OS=Corynebacterium glutamicum (strain R) GN=rpsB PE=3 SV=1 146 350 8.0E-27
sp|A9KUK5|RS2_SHEB9 30S ribosomal protein S2 OS=Shewanella baltica (strain OS195) GN=rpsB PE=3 SV=1 146 356 8.0E-27
sp|A6WLA6|RS2_SHEB8 30S ribosomal protein S2 OS=Shewanella baltica (strain OS185) GN=rpsB PE=3 SV=1 146 356 8.0E-27
sp|A3D2K5|RS2_SHEB5 30S ribosomal protein S2 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rpsB PE=3 SV=1 146 356 8.0E-27
sp|B8E7R6|RS2_SHEB2 30S ribosomal protein S2 OS=Shewanella baltica (strain OS223) GN=rpsB PE=3 SV=1 146 356 8.0E-27
sp|A8LK91|RS2_DINSH 30S ribosomal protein S2 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rpsB PE=3 SV=1 145 354 8.0E-27
sp|A1RLM7|RS2_SHESW 30S ribosomal protein S2 OS=Shewanella sp. (strain W3-18-1) GN=rpsB PE=3 SV=1 146 356 8.0E-27
sp|A4Y543|RS2_SHEPC 30S ribosomal protein S2 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rpsB PE=3 SV=1 146 356 8.0E-27
sp|A7M8Z3|RR2_CUSGR Plastid 30S ribosomal protein S2 OS=Cuscuta gronovii GN=rps2 PE=2 SV=2 145 353 8.0E-27
sp|C1F401|RS2_ACIC5 30S ribosomal protein S2 OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=rpsB PE=3 SV=1 145 332 8.0E-27
sp|Q8NP01|RS2_CORGL 30S ribosomal protein S2 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=rpsB PE=3 SV=1 146 350 9.0E-27
sp|A6MMT3|RR2_ILLOL 30S ribosomal protein S2, chloroplastic OS=Illicium oligandrum GN=rps2 PE=3 SV=1 145 353 9.0E-27
sp|P66540|RS2_NEIMB 30S ribosomal protein S2 OS=Neisseria meningitidis serogroup B (strain MC58) GN=rpsB PE=1 SV=1 146 353 1.0E-26
sp|P66539|RS2_NEIMA 30S ribosomal protein S2 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rpsB PE=3 SV=1 146 353 1.0E-26
sp|Q2JLB3|RS2_SYNJB 30S ribosomal protein S2 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=rpsB PE=3 SV=1 146 351 1.0E-26
sp|P08242|RR2_SPIOL 30S ribosomal protein S2, chloroplastic OS=Spinacia oleracea GN=rps2 PE=1 SV=1 145 353 1.0E-26
sp|Q7YJY1|RR2_CALFG 30S ribosomal protein S2, chloroplastic OS=Calycanthus floridus var. glaucus GN=rps2 PE=3 SV=1 146 354 1.0E-26
sp|A0A324|RR2_COFAR 30S ribosomal protein S2, chloroplastic OS=Coffea arabica GN=rps2 PE=3 SV=1 145 353 1.0E-26
sp|Q6MEY9|RS2_PARUW 30S ribosomal protein S2 OS=Protochlamydia amoebophila (strain UWE25) GN=rpsB PE=3 SV=1 146 342 1.0E-26
sp|Q7VYD0|RS2_BORPE 30S ribosomal protein S2 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rpsB PE=3 SV=1 151 351 1.0E-26
sp|Q7WA60|RS2_BORPA 30S ribosomal protein S2 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rpsB PE=3 SV=1 151 351 1.0E-26
sp|Q7WJ94|RS2_BORBR 30S ribosomal protein S2 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rpsB PE=3 SV=1 151 351 1.0E-26
sp|Q06GS1|RR2_PIPCE 30S ribosomal protein S2, chloroplastic OS=Piper cenocladum GN=rps2 PE=3 SV=1 145 353 1.0E-26
sp|Q2PMT2|RR2_SOYBN 30S ribosomal protein S2, chloroplastic OS=Glycine max GN=rps2 PE=3 SV=1 145 354 1.0E-26
sp|A9M489|RS2_NEIM0 30S ribosomal protein S2 OS=Neisseria meningitidis serogroup C (strain 053442) GN=rpsB PE=3 SV=1 146 353 1.0E-26
sp|Q0HT62|RS2_SHESR 30S ribosomal protein S2 OS=Shewanella sp. (strain MR-7) GN=rpsB PE=3 SV=1 146 356 1.0E-26
sp|Q0HGV5|RS2_SHESM 30S ribosomal protein S2 OS=Shewanella sp. (strain MR-4) GN=rpsB PE=3 SV=1 146 356 1.0E-26
sp|A0KZ23|RS2_SHESA 30S ribosomal protein S2 OS=Shewanella sp. (strain ANA-3) GN=rpsB PE=3 SV=1 146 356 1.0E-26
sp|Q8EGH5|RS2_SHEON 30S ribosomal protein S2 OS=Shewanella oneidensis (strain MR-1) GN=rpsB PE=3 SV=1 146 356 1.0E-26
sp|Q7MAK0|RS2_WOLSU 30S ribosomal protein S2 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=rpsB PE=3 SV=1 146 347 1.0E-26
sp|Q03WX5|RS2_LEUMM 30S ribosomal protein S2 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rpsB PE=3 SV=1 146 354 1.0E-26
sp|Q6ENI1|RR2_ORYNI 30S ribosomal protein S2, chloroplastic OS=Oryza nivara GN=rps2 PE=3 SV=1 145 353 1.0E-26
sp|Q165Z3|RS2_ROSDO 30S ribosomal protein S2 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rpsB PE=3 SV=1 145 354 1.0E-26
sp|A1WHU2|RS2_VEREI 30S ribosomal protein S2 OS=Verminephrobacter eiseniae (strain EF01-2) GN=rpsB PE=3 SV=1 146 365 1.0E-26
sp|A5ICL0|RS2_LEGPC 30S ribosomal protein S2 OS=Legionella pneumophila (strain Corby) GN=rpsB PE=3 SV=1 145 349 1.0E-26
sp|Q5X4J7|RS2_LEGPA 30S ribosomal protein S2 OS=Legionella pneumophila (strain Paris) GN=rpsB PE=3 SV=1 145 349 1.0E-26
sp|A5EV13|RS2_DICNV 30S ribosomal protein S2 OS=Dichelobacter nodosus (strain VCS1703A) GN=rpsB PE=3 SV=1 146 332 1.0E-26
sp|A1KWH6|RS2_NEIMF 30S ribosomal protein S2 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rpsB PE=3 SV=1 146 353 1.0E-26
sp|Q98Q36|RS2_MYCPU 30S ribosomal protein S2 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=rpsB PE=3 SV=1 151 342 1.0E-26
sp|Q09FX2|RR2_NANDO 30S ribosomal protein S2, chloroplastic OS=Nandina domestica GN=rps2 PE=3 SV=1 145 353 1.0E-26
sp|Q5ZUS8|RS2_LEGPH 30S ribosomal protein S2 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rpsB PE=3 SV=2 145 349 1.0E-26
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0008152 metabolic process No
GO:0043228 non-membrane-bounded organelle No
GO:0043603 cellular amide metabolic process No
GO:0043229 intracellular organelle No
GO:0009059 macromolecule biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0005198 structural molecule activity No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0044238 primary metabolic process No
GO:0043226 organelle No
GO:0019538 protein metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006518 peptide metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043604 amide biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0044260 cellular macromolecule metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0043043 peptide biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5791
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|662 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3712
Ophiocordyceps camponoti-floridani Ophcf2|03176
Ophiocordyceps camponoti-rufipedis Ophun1|6842
Ophiocordyceps kimflemingae Ophio5|429
Ophiocordyceps subramaniannii Hirsu2|9783

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|662
MTTQAVELAMHRCSLTLGQGHRVTVSARPWHGVRTLSGLDKTAAKTQRYGGDGMGSRLVPKPLLSTKRKQRRIAE
GTMTLRADSVVKRQGGAWTKPHEFGDKKLSPAEQYIEYRRFRKQTQGLGSKVEQRYVPGELIANPAGPEDVTLEM
LMAAQTHMGHCTSLWNPSNSRYIYGARQGIHIISLETTAAHLRRAARVVEGVSYNGGLILFTGTRKGQMEIVTMA
AELSGGCHLFTKWIPGGITNRDVILQFKDIKVVNHMDHEIKGFEAYKNIARPLLPDLVVCLNPLENYVLLQECAN
KGIPTIGIIDTNVEPSWVTYTIPANDDSLRAVAVIAGVLGKAGQRGKDQRLREAAQGSVPWSTPEALRRHMRKEV
LAALRKKQAAMAMAMNKDEEKEQGGEEDEHKLLRKRYDDEMFDVGDEEMLAILGKASMGGGPQDVGGGESRLREK
E*
Coding >OphauG2|662
ATGACGACGCAGGCAGTAGAACTGGCCATGCATAGGTGTAGCCTGACATTAGGGCAGGGTCACCGCGTCACTGTG
TCAGCGAGACCTTGGCATGGTGTGCGGACGCTCTCGGGTTTAGACAAGACTGCAGCAAAGACTCAGCGTTACGGC
GGAGATGGCATGGGATCGAGACTGGTCCCGAAGCCACTCCTGTCGACGAAGAGGAAACAGCGACGGATTGCAGAA
GGCACAATGACTCTCAGAGCAGACTCGGTGGTGAAACGGCAGGGTGGTGCATGGACGAAACCGCACGAATTCGGA
GACAAGAAGCTTTCGCCTGCAGAGCAATACATTGAGTATCGGCGGTTTCGCAAGCAGACGCAAGGGTTAGGGTCC
AAGGTTGAGCAGCGATATGTGCCCGGGGAGCTCATCGCCAACCCGGCTGGACCAGAGGACGTGACACTTGAGATG
TTAATGGCAGCACAGACGCACATGGGCCACTGCACATCGCTCTGGAATCCTTCAAATTCACGGTATATATATGGC
GCACGTCAGGGAATTCACATCATCTCGCTAGAAACAACGGCAGCTCACTTGCGACGGGCGGCCCGCGTGGTTGAA
GGAGTGTCGTACAACGGGGGCCTCATTCTGTTTACTGGGACGCGCAAGGGCCAGATGGAAATTGTCACCATGGCG
GCTGAGCTGTCAGGAGGCTGCCACTTGTTTACCAAGTGGATTCCCGGGGGCATCACAAATCGGGACGTTATACTC
CAGTTCAAGGACATCAAGGTGGTTAACCATATGGACCACGAGATCAAGGGATTTGAGGCATATAAGAACATTGCG
AGGCCGTTGCTACCAGACCTAGTGGTTTGCCTCAATCCCCTGGAGAACTATGTCTTGCTGCAAGAGTGTGCCAAC
AAGGGGATCCCGACGATTGGTATTATCGACACCAATGTGGAGCCATCTTGGGTTACTTATACGATACCGGCCAAT
GACGACAGTTTGCGAGCTGTGGCGGTAATAGCCGGGGTGCTGGGAAAAGCGGGCCAAAGAGGCAAGGATCAGAGG
CTTCGTGAGGCTGCTCAAGGCAGCGTGCCATGGAGCACGCCGGAAGCGCTGCGTCGACACATGAGGAAGGAAGTT
TTGGCGGCGCTTAGGAAGAAGCAGGCAGCCATGGCAATGGCGATGAACAAGGACGAAGAAAAGGAGCAAGGAGGG
GAGGAGGATGAGCACAAGCTGCTACGGAAGCGGTACGATGACGAGATGTTTGACGTGGGCGACGAAGAGATGCTG
GCGATACTGGGCAAGGCGTCGATGGGAGGGGGGCCGCAAGATGTGGGGGGGGGAGAGTCTAGGTTGAGGGAGAAG
GAGTAG
Transcript >OphauG2|662
ATGACGACGCAGGCAGTAGAACTGGCCATGCATAGGTGTAGCCTGACATTAGGGCAGGGTCACCGCGTCACTGTG
TCAGCGAGACCTTGGCATGGTGTGCGGACGCTCTCGGGTTTAGACAAGACTGCAGCAAAGACTCAGCGTTACGGC
GGAGATGGCATGGGATCGAGACTGGTCCCGAAGCCACTCCTGTCGACGAAGAGGAAACAGCGACGGATTGCAGAA
GGCACAATGACTCTCAGAGCAGACTCGGTGGTGAAACGGCAGGGTGGTGCATGGACGAAACCGCACGAATTCGGA
GACAAGAAGCTTTCGCCTGCAGAGCAATACATTGAGTATCGGCGGTTTCGCAAGCAGACGCAAGGGTTAGGGTCC
AAGGTTGAGCAGCGATATGTGCCCGGGGAGCTCATCGCCAACCCGGCTGGACCAGAGGACGTGACACTTGAGATG
TTAATGGCAGCACAGACGCACATGGGCCACTGCACATCGCTCTGGAATCCTTCAAATTCACGGTATATATATGGC
GCACGTCAGGGAATTCACATCATCTCGCTAGAAACAACGGCAGCTCACTTGCGACGGGCGGCCCGCGTGGTTGAA
GGAGTGTCGTACAACGGGGGCCTCATTCTGTTTACTGGGACGCGCAAGGGCCAGATGGAAATTGTCACCATGGCG
GCTGAGCTGTCAGGAGGCTGCCACTTGTTTACCAAGTGGATTCCCGGGGGCATCACAAATCGGGACGTTATACTC
CAGTTCAAGGACATCAAGGTGGTTAACCATATGGACCACGAGATCAAGGGATTTGAGGCATATAAGAACATTGCG
AGGCCGTTGCTACCAGACCTAGTGGTTTGCCTCAATCCCCTGGAGAACTATGTCTTGCTGCAAGAGTGTGCCAAC
AAGGGGATCCCGACGATTGGTATTATCGACACCAATGTGGAGCCATCTTGGGTTACTTATACGATACCGGCCAAT
GACGACAGTTTGCGAGCTGTGGCGGTAATAGCCGGGGTGCTGGGAAAAGCGGGCCAAAGAGGCAAGGATCAGAGG
CTTCGTGAGGCTGCTCAAGGCAGCGTGCCATGGAGCACGCCGGAAGCGCTGCGTCGACACATGAGGAAGGAAGTT
TTGGCGGCGCTTAGGAAGAAGCAGGCAGCCATGGCAATGGCGATGAACAAGGACGAAGAAAAGGAGCAAGGAGGG
GAGGAGGATGAGCACAAGCTGCTACGGAAGCGGTACGATGACGAGATGTTTGACGTGGGCGACGAAGAGATGCTG
GCGATACTGGGCAAGGCGTCGATGGGAGGGGGGCCGCAAGATGTGGGGGGGGGAGAGTCTAGGTTGAGGGAGAAG
GAGTAG
Gene >OphauG2|662
ATGACGACGCAGGCAGTAGAACTGGCCATGCATAGGTGTAGCCTGACATTAGGGCAGGGTAAGGATTGTTTCCAG
GCCTTCTAGCTTGAAGCTGCTGCTCATTTCTCTGCAGGTCACCGCGTCACTGTGTCAGCGAGACCTTGGCATGGT
GTGCGGACGCTCTCGGGTTTAGACAAGACTGCAGCAAAGACTCAGCGTTACGGCGGAGATGGCATGGGATCGAGA
CTGGTCCCGAAGCCACTCCTGTCGACGAAGAGGAAACAGCGACGGATTGCAGAAGGCACAATGACTCTCAGAGCA
GACTCGGTGGTGAAACGGCAGGGTGGTGCATGGACGAAACCGCACGAATTCGGAGACAAGAAGCTTTCGCCTGCA
GAGCAATACATTGAGTATCGGCGGTTTCGCAAGCAGACGCAAGGGTTAGGGTCCAAGGTTGAGCAGCGATATGTG
CCCGGGGAGCTCATCGCCAACCCGGCTGGACCAGAGGACGTGACACTTGAGATGTTAATGGCAGCACAGACGCAC
ATGGGCCACTGCACATCGCTCTGGAATCCTTCAAATTCACGGTATATATATGGCGCACGTCAGGGAATTCACATC
ATCTCGCTAGAAACAACGGCAGCTCACTTGCGACGGGCGGCCCGCGTGGTTGAAGGAGTGTCGTACAACGGGGGC
CTCATTCTGTTTACTGGGACGCGCAAGGGCCAGATGGAAATTGTCACCATGGCGGCTGAGCTGTCAGGAGGCTGC
CACTTGTTTACCAAGTGGATTCCCGGGGGCATCACAAATCGGGACGTTATACTCCAGTTCAAGGACATCAAGGTG
GTTAACCATATGGACCACGAGATCAAGGGATTTGAGGCATATAAGAACATTGCGAGGCCGTTGCTACCAGACCTA
GTGGTTTGCCTCAATCCCCTGGAGAACTATGTCTTGCTGCAAGAGTGTGCCAACAAGGGGATCCCGACGATTGGT
ATTATCGACACCAATGTGGAGCCATCTTGGGTTACTTATACGATACCGGCCAATGACGACAGGTAAGGAATGACG
GATTGCAAGCAAGGTGTATGTGGCAATGCAAGGCTGATGAGGAGATGTAGTTTGCGAGCTGTGGCGGTAATAGCC
GGGGTGCTGGGAAAAGCGGGCCAAAGAGGCAAGGATCAGAGGCTTCGTGAGGCTGCTCAAGGCAGCGTGCCATGG
AGCACGCCGGAAGCGCTGCGTCGACACATGAGGAAGGAAGTTTTGGCGGCGCTTAGGAAGAAGCAGGCAGCCATG
GCAATGGCGATGAACAAGGACGAAGAAAAGGAGCAAGGAGGGGAGGAGGATGAGCACAAGCTGCTACGGAAGCGG
TACGATGACGAGATGTTTGACGTGGGCGACGAAGAGATGCTGGCGATACTGGGCAAGGCGTCGATGGGAGGGGGG
CCGCAAGATGTGGGGGGGGGAGAGTCTAGGTTGAGGGAGAAGGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail