Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6609
Gene name
LocationContig_698:5350..7170
Strand-
Gene length (bp)1820
Transcript length (bp)1674
Coding sequence length (bp)1674
Protein length (aa) 558

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01019 G_glu_transpept Gamma-glutamyltranspeptidase 4.5E-157 46 550

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B387|GGT1_ARTBC Gamma-glutamyltransferase ARB_02921 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02921 PE=1 SV=1 29 557 0.0E+00
sp|O14194|GGT2_SCHPO Gamma-glutamyltranspeptidase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ggt2 PE=2 SV=1 31 520 3.0E-107
sp|Q9US04|GGT1_SCHPO Gamma-glutamyltranspeptidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ggt1 PE=2 SV=1 29 549 5.0E-107
sp|P20735|GGT1_PIG Gamma-glutamyltranspeptidase 1 OS=Sus scrofa GN=GGT1 PE=2 SV=1 32 549 3.0E-104
sp|P07314|GGT1_RAT Gamma-glutamyltranspeptidase 1 OS=Rattus norvegicus GN=Ggt1 PE=1 SV=4 24 549 2.0E-103
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B387|GGT1_ARTBC Gamma-glutamyltransferase ARB_02921 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02921 PE=1 SV=1 29 557 0.0E+00
sp|O14194|GGT2_SCHPO Gamma-glutamyltranspeptidase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ggt2 PE=2 SV=1 31 520 3.0E-107
sp|Q9US04|GGT1_SCHPO Gamma-glutamyltranspeptidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ggt1 PE=2 SV=1 29 549 5.0E-107
sp|P20735|GGT1_PIG Gamma-glutamyltranspeptidase 1 OS=Sus scrofa GN=GGT1 PE=2 SV=1 32 549 3.0E-104
sp|P07314|GGT1_RAT Gamma-glutamyltranspeptidase 1 OS=Rattus norvegicus GN=Ggt1 PE=1 SV=4 24 549 2.0E-103
sp|P19440|GGT1_HUMAN Gamma-glutamyltranspeptidase 1 OS=Homo sapiens GN=GGT1 PE=1 SV=2 32 549 3.0E-101
sp|Q680I5|GAGT2_ARATH Gamma-glutamyltranspeptidase 2 OS=Arabidopsis thaliana GN=GGT2 PE=2 SV=1 31 503 4.0E-101
sp|Q60928|GGT1_MOUSE Gamma-glutamyltranspeptidase 1 OS=Mus musculus GN=Ggt1 PE=1 SV=1 24 549 1.0E-98
sp|A6NGU5|GGT3_HUMAN Putative gamma-glutamyltranspeptidase 3 OS=Homo sapiens GN=GGT3P PE=5 SV=2 32 549 6.0E-95
sp|P36268|GGT2_HUMAN Inactive gamma-glutamyltranspeptidase 2 OS=Homo sapiens GN=GGT2 PE=1 SV=3 32 539 2.0E-92
sp|Q8VYW6|GAGT1_ARATH Gamma-glutamyltranspeptidase 1 OS=Arabidopsis thaliana GN=GGT1 PE=2 SV=1 4 503 4.0E-90
sp|Q9M0G0|GAGT3_ARATH Gamma-glutamyltranspeptidase 3 OS=Arabidopsis thaliana GN=GGT3 PE=2 SV=1 31 503 5.0E-90
sp|P18956|GGT_ECOLI Gamma-glutamyltranspeptidase OS=Escherichia coli (strain K12) GN=ggt PE=1 SV=1 29 548 3.0E-83
sp|P36267|GGT_PSEUA Gamma-glutamyltranspeptidase OS=Pseudomonas sp. (strain A14) GN=ggt PE=1 SV=1 7 502 1.0E-79
sp|Q9I406|GGT_PSEAE Gamma-glutamyltranspeptidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ggt PE=3 SV=1 31 548 1.0E-72
sp|Q05902|ECM38_YEAST Gamma-glutamyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM38 PE=1 SV=1 31 502 1.0E-61
sp|P15557|PAC1_PSES3 Acylase ACY 1 OS=Pseudomonas sp. (strain SE83) GN=acyI PE=1 SV=2 31 556 1.0E-59
sp|Q05053|PAC1_PSESV Acylase ACY 1 OS=Pseudomonas sp. (strain V22) GN=acyI PE=1 SV=2 19 556 8.0E-59
sp|Q9UJ14|GGT7_HUMAN Gamma-glutamyltransferase 7 OS=Homo sapiens GN=GGT7 PE=1 SV=2 31 557 7.0E-58
sp|Q9QWE9|GGT5_RAT Gamma-glutamyltransferase 5 OS=Rattus norvegicus GN=Ggt5 PE=2 SV=1 32 491 1.0E-57
sp|Q0V8L2|GGT7_BOVIN Gamma-glutamyltransferase 7 OS=Bos taurus GN=GGT7 PE=2 SV=1 31 557 2.0E-57
sp|Q99MZ4|GGT7_RAT Gamma-glutamyltransferase 7 OS=Rattus norvegicus GN=Ggt7 PE=1 SV=2 31 557 7.0E-57
sp|P36269|GGT5_HUMAN Gamma-glutamyltransferase 5 OS=Homo sapiens GN=GGT5 PE=1 SV=2 36 491 6.0E-56
sp|Q99JP7|GGT7_MOUSE Gamma-glutamyltransferase 7 OS=Mus musculus GN=Ggt7 PE=1 SV=2 31 557 2.0E-55
sp|P54422|GGT_BACSU Gamma-glutamyltranspeptidase OS=Bacillus subtilis (strain 168) GN=ggt PE=1 SV=1 29 557 7.0E-55
sp|Q9Z2A9|GGT5_MOUSE Gamma-glutamyltransferase 5 OS=Mus musculus GN=Ggt5 PE=1 SV=2 32 491 1.0E-53
sp|P63186|GGT_BACNA Gamma-glutamyltranspeptidase OS=Bacillus subtilis subsp. natto GN=ggt PE=1 SV=1 29 542 2.0E-52
sp|Q9BX51|GGTL1_HUMAN Gamma-glutamyltransferase light chain 1 OS=Homo sapiens GN=GGTLC1 PE=2 SV=2 330 549 2.0E-35
sp|P74181|GGT_SYNY3 Gamma-glutamyltranspeptidase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ggt PE=3 SV=1 31 557 2.0E-33
sp|B5MD39|GGTL3_HUMAN Putative gamma-glutamyltransferase light chain 3 OS=Homo sapiens GN=GGTLC3 PE=5 SV=1 330 549 2.0E-32
sp|Q9CAR5|GAGT4_ARATH Putative inactive gamma-glutamyltranspeptidase 4 OS=Arabidopsis thaliana GN=GGT4 PE=5 SV=1 312 503 4.0E-32
sp|Q51693|CAPD_BACAN Capsule biosynthesis protein CapD OS=Bacillus anthracis GN=capD PE=1 SV=2 32 463 7.0E-32
sp|Q14390|GGTL2_HUMAN Gamma-glutamyltransferase light chain 2 OS=Homo sapiens GN=GGTLC2 PE=2 SV=4 330 549 1.0E-25
sp|O05218|YWRD_BACSU Putative gamma-glutamyltransferase YwrD OS=Bacillus subtilis (strain 168) GN=ywrD PE=1 SV=1 33 489 4.0E-25
sp|A7YWM1|GGT6_BOVIN Gamma-glutamyltransferase 6 OS=Bos taurus GN=GGT6 PE=2 SV=1 31 173 6.0E-12
sp|Q6IE08|GGT6_RAT Gamma-glutamyltransferase 6 OS=Rattus norvegicus GN=Ggt6 PE=2 SV=1 32 219 2.0E-11
sp|Q6PDE7|GGT6_MOUSE Gamma-glutamyltransferase 6 OS=Mus musculus GN=Ggt6 PE=2 SV=1 32 173 1.0E-10
sp|Q6P531|GGT6_HUMAN Gamma-glutamyltransferase 6 OS=Homo sapiens GN=GGT6 PE=2 SV=2 33 173 8.0E-09
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.9034

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup194
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3230
Ophiocordyceps australis 1348a (Ghana) OphauG2|6609 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1642
Ophiocordyceps australis map64 (Brazil) OphauB2|3863
Ophiocordyceps camponoti-floridani Ophcf2|02409
Ophiocordyceps camponoti-floridani Ophcf2|06740
Ophiocordyceps camponoti-rufipedis Ophun1|2588
Ophiocordyceps camponoti-rufipedis Ophun1|858
Ophiocordyceps kimflemingae Ophio5|6050
Ophiocordyceps kimflemingae Ophio5|914
Ophiocordyceps subramaniannii Hirsu2|7282
Ophiocordyceps subramaniannii Hirsu2|9336

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6609
MAPLLRLASSLLFLSAATLAAYDPEQPPKIGAVASESAVCSQIGRQLLKIGGNAADAMLGTVLCVGIVAMYHSGI
GGGGFMTIRLPNGTYESVDFRETAPAAAFESMFEDNVEASKVGGLASGVPGELRGLDYLHRKYGKLPWVQVFQPI
IKLARAGFVVTEELARFMDAQKTPFLTDDPAWAVDFAPQGKRVQKADIMTRKRYANTLEDIANYGVDVFYTGAMA
KATVAAVQARNGIMTMADLANYTVKHREAVHVEYRGHKLTSCNTPASGVVALSALNIVSGYEPLDNMGALSTHRL
DEAFKFAFGQRVNLGDPDFVAGMDEYTAKMISPQTGASLRSRISNATTHEPDWYDSERLEVPEMAGTSFIATADA
SGMAIALTTSLNLGFGSRVMVPETGIVMNSQMNDFGIPGSSDAYGYKASAANLVGPGKRPLSSISPVIGETPDGR
LSFSVGGAGGSRIITATAQAIVHLIDQQMSMLEALKQPRLHDQLIPSVVTFEDGFDNKTVDFMRRLHHNVSWVAP
GQSSVQGVRQLPNGTFEAAGEPRQASSGGFAI*
Coding >OphauG2|6609
ATGGCGCCTCTACTCAGACTGGCGAGCAGCCTGCTCTTCCTCTCGGCAGCCACACTCGCGGCATACGACCCCGAA
CAGCCGCCCAAGATTGGGGCCGTGGCCTCGGAGAGTGCTGTGTGTAGCCAAATCGGCAGGCAGCTGCTAAAGATT
GGCGGCAACGCGGCAGACGCCATGTTGGGCACGGTGCTCTGTGTGGGCATTGTGGCCATGTATCATAGCGGCATC
GGAGGCGGAGGCTTCATGACGATACGCTTGCCAAACGGGACGTATGAGAGTGTCGATTTTCGAGAGACGGCGCCG
GCGGCGGCGTTTGAGAGCATGTTTGAGGATAATGTCGAGGCCAGCAAGGTGGGGGGGCTTGCGAGCGGCGTGCCA
GGAGAGCTAAGAGGACTCGACTACCTTCACAGAAAGTACGGAAAGCTGCCCTGGGTCCAAGTCTTCCAGCCCATC
ATCAAGCTGGCACGCGCCGGCTTCGTCGTGACTGAGGAACTGGCCAGATTCATGGATGCCCAAAAGACGCCCTTT
TTGACCGACGACCCGGCCTGGGCAGTCGACTTTGCGCCCCAGGGCAAACGAGTGCAAAAGGCGGACATTATGACA
CGCAAACGCTACGCCAATACTCTTGAAGACATTGCCAACTATGGCGTCGACGTCTTTTACACTGGAGCCATGGCC
AAGGCAACAGTTGCCGCCGTCCAGGCTCGCAACGGCATCATGACAATGGCCGACCTGGCAAACTATACCGTCAAG
CACAGGGAGGCTGTGCATGTGGAATACCGCGGCCATAAGCTGACAAGCTGCAACACACCAGCGAGCGGAGTGGTG
GCTCTGAGTGCCCTGAATATTGTGAGTGGTTATGAGCCGCTGGACAACATGGGCGCCTTGTCGACGCATCGGCTC
GACGAGGCCTTCAAGTTTGCATTTGGGCAGCGAGTAAACCTGGGCGATCCGGATTTTGTGGCCGGCATGGACGAG
TATACGGCCAAGATGATTTCGCCGCAAACAGGGGCGTCTCTCCGCTCGCGGATTTCCAACGCGACAACACATGAG
CCGGACTGGTACGACTCGGAGAGACTCGAGGTCCCCGAGATGGCTGGCACATCCTTCATCGCGACAGCCGATGCC
AGCGGAATGGCCATAGCGCTGACGACGTCGCTCAACCTCGGCTTCGGGTCCCGCGTCATGGTTCCCGAGACTGGC
ATCGTCATGAACAGCCAGATGAACGACTTTGGCATCCCGGGCAGCTCGGATGCCTACGGCTACAAGGCCAGCGCG
GCCAATCTTGTGGGACCGGGCAAACGGCCGCTGTCATCGATTTCGCCCGTGATTGGCGAGACGCCCGACGGCCGC
CTGTCGTTTAGTGTGGGAGGCGCGGGAGGCAGCCGCATCATCACGGCCACGGCACAGGCCATTGTGCACTTGATT
GATCAACAGATGAGCATGCTGGAGGCGCTAAAGCAGCCACGGTTGCACGACCAGCTGATACCCAGTGTGGTGACG
TTTGAGGACGGGTTTGACAACAAGACGGTGGATTTCATGAGGCGGCTGCACCACAATGTGTCGTGGGTGGCGCCG
GGACAGAGTTCTGTGCAGGGGGTGCGGCAGTTGCCAAATGGGACGTTTGAAGCGGCTGGAGAGCCGAGACAGGCG
AGCTCGGGGGGGTTTGCAATCTAG
Transcript >OphauG2|6609
ATGGCGCCTCTACTCAGACTGGCGAGCAGCCTGCTCTTCCTCTCGGCAGCCACACTCGCGGCATACGACCCCGAA
CAGCCGCCCAAGATTGGGGCCGTGGCCTCGGAGAGTGCTGTGTGTAGCCAAATCGGCAGGCAGCTGCTAAAGATT
GGCGGCAACGCGGCAGACGCCATGTTGGGCACGGTGCTCTGTGTGGGCATTGTGGCCATGTATCATAGCGGCATC
GGAGGCGGAGGCTTCATGACGATACGCTTGCCAAACGGGACGTATGAGAGTGTCGATTTTCGAGAGACGGCGCCG
GCGGCGGCGTTTGAGAGCATGTTTGAGGATAATGTCGAGGCCAGCAAGGTGGGGGGGCTTGCGAGCGGCGTGCCA
GGAGAGCTAAGAGGACTCGACTACCTTCACAGAAAGTACGGAAAGCTGCCCTGGGTCCAAGTCTTCCAGCCCATC
ATCAAGCTGGCACGCGCCGGCTTCGTCGTGACTGAGGAACTGGCCAGATTCATGGATGCCCAAAAGACGCCCTTT
TTGACCGACGACCCGGCCTGGGCAGTCGACTTTGCGCCCCAGGGCAAACGAGTGCAAAAGGCGGACATTATGACA
CGCAAACGCTACGCCAATACTCTTGAAGACATTGCCAACTATGGCGTCGACGTCTTTTACACTGGAGCCATGGCC
AAGGCAACAGTTGCCGCCGTCCAGGCTCGCAACGGCATCATGACAATGGCCGACCTGGCAAACTATACCGTCAAG
CACAGGGAGGCTGTGCATGTGGAATACCGCGGCCATAAGCTGACAAGCTGCAACACACCAGCGAGCGGAGTGGTG
GCTCTGAGTGCCCTGAATATTGTGAGTGGTTATGAGCCGCTGGACAACATGGGCGCCTTGTCGACGCATCGGCTC
GACGAGGCCTTCAAGTTTGCATTTGGGCAGCGAGTAAACCTGGGCGATCCGGATTTTGTGGCCGGCATGGACGAG
TATACGGCCAAGATGATTTCGCCGCAAACAGGGGCGTCTCTCCGCTCGCGGATTTCCAACGCGACAACACATGAG
CCGGACTGGTACGACTCGGAGAGACTCGAGGTCCCCGAGATGGCTGGCACATCCTTCATCGCGACAGCCGATGCC
AGCGGAATGGCCATAGCGCTGACGACGTCGCTCAACCTCGGCTTCGGGTCCCGCGTCATGGTTCCCGAGACTGGC
ATCGTCATGAACAGCCAGATGAACGACTTTGGCATCCCGGGCAGCTCGGATGCCTACGGCTACAAGGCCAGCGCG
GCCAATCTTGTGGGACCGGGCAAACGGCCGCTGTCATCGATTTCGCCCGTGATTGGCGAGACGCCCGACGGCCGC
CTGTCGTTTAGTGTGGGAGGCGCGGGAGGCAGCCGCATCATCACGGCCACGGCACAGGCCATTGTGCACTTGATT
GATCAACAGATGAGCATGCTGGAGGCGCTAAAGCAGCCACGGTTGCACGACCAGCTGATACCCAGTGTGGTGACG
TTTGAGGACGGGTTTGACAACAAGACGGTGGATTTCATGAGGCGGCTGCACCACAATGTGTCGTGGGTGGCGCCG
GGACAGAGTTCTGTGCAGGGGGTGCGGCAGTTGCCAAATGGGACGTTTGAAGCGGCTGGAGAGCCGAGACAGGCG
AGCTCGGGGGGGTTTGCAATCTAG
Gene >OphauG2|6609
ATGGCGCCTCTACTCAGACTGGCGAGCAGCCTGCTCTTCCTCTCGGCAGCCACACTCGCGGCATACGACCCCGAA
CAGCCGCCCAAGATTGGGGCCGTGGCCTCGGAGAGTGCTGTGTGTAGCCAAATCGGCAGGCAGCTGCTAAAGATT
GGCGGCAACGCGGCAGACGCCATGTTGGGCACGGTGCTCTGTGTGGGCATTGTGGCCATGTATCATAGCGGCATC
GGAGGCGGAGGCTTCATGACGATACGCTTGCCAAACGGGACGTATGAGAGTGTCGATTTTCGAGAGACGGCGCCG
GCGGCGGCGTTTGAGAGCATGTTTGAGGATAATGTCGAGGCCAGCAAGGTGGGGGGGCTTGCGAGGTGAGTTGAA
ATTATATCCTGCTATTGCAACATATTTCTTTCTTTTTGGCATGGTCATGTATATCCCTTTACTACCTACAATGTA
TCCCTTTCTTTTTGGCATGGTCGAGTAAAAGAAATGCTTCGACTAACTGTAAAGGACGCAGCGGCGTGCCAGGAG
AGCTAAGAGGACTCGACTACCTTCACAGAAAGTACGGAAAGCTGCCCTGGGTCCAAGTCTTCCAGCCCATCATCA
AGCTGGCACGCGCCGGCTTCGTCGTGACTGAGGAACTGGCCAGATTCATGGATGCCCAAAAGACGCCCTTTTTGA
CCGACGACCCGGCCTGGGCAGTCGACTTTGCGCCCCAGGGCAAACGAGTGCAAAAGGCGGACATTATGACACGCA
AACGCTACGCCAATACTCTTGAAGACATTGCCAACTATGGCGTCGACGTCTTTTACACTGGAGCCATGGCCAAGG
CAACAGTTGCCGCCGTCCAGGCTCGCAACGGCATCATGACAATGGCCGACCTGGCAAACTATACCGTCAAGCACA
GGGAGGCTGTGCATGTGGAATACCGCGGCCATAAGCTGACAAGCTGCAACACACCAGCGAGCGGAGTGGTGGCTC
TGAGTGCCCTGAATATTGTGAGTGGTTATGAGCCGCTGGACAACATGGGCGCCTTGTCGACGCATCGGCTCGACG
AGGCCTTCAAGTTTGCATTTGGGCAGCGAGTAAACCTGGGCGATCCGGATTTTGTGGCCGGCATGGACGAGTATA
CGGCCAAGATGATTTCGCCGCAAACAGGGGCGTCTCTCCGCTCGCGGATTTCCAACGCGACAACACATGAGCCGG
ACTGGTACGACTCGGAGAGACTCGAGGTCCCCGAGATGGCTGGCACATCCTTCATCGCGACAGCCGATGCCAGCG
GAATGGCCATAGCGCTGACGACGTCGCTCAACCTCGGCTTCGGGTCCCGCGTCATGGTTCCCGAGACTGGCATCG
TCATGAACAGCCAGATGAACGACTTTGGCATCCCGGGCAGCTCGGATGCCTACGGCTACAAGGCCAGCGCGGCCA
ATCTTGTGGGACCGGGCAAACGGCCGCTGTCATCGATTTCGCCCGTGATTGGCGAGACGCCCGACGGCCGCCTGT
CGTTTAGTGTGGGAGGCGCGGGAGGCAGCCGCATCATCACGGCCACGGCACAGGCCATTGTGCACTTGATTGATC
AACAGATGAGCATGCTGGAGGCGCTAAAGCAGCCACGGTTGCACGACCAGCTGATACCCAGTGTGGTGACGTTTG
AGGACGGGTTTGACAACAAGACGGTGGATTTCATGAGGCGGCTGCACCACAATGTGTCGTGGGTGGCGCCGGGAC
AGAGTTCTGTGCAGGGGGTGCGGCAGTTGCCAAATGGGACGTTTGAAGCGGCTGGAGAGCCGAGACAGGCGAGCT
CGGGGGGGTTTGCAATCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail