Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6609
Gene name
LocationContig_698:5350..7170
Strand-
Gene length (bp)1820
Transcript length (bp)1674
Coding sequence length (bp)1674
Protein length (aa) 558

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01019 G_glu_transpept Gamma-glutamyltranspeptidase 4.5E-157 46 550

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B387|GGT1_ARTBC Gamma-glutamyltransferase ARB_02921 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02921 PE=1 SV=1 29 557 0.0E+00
sp|O14194|GGT2_SCHPO Gamma-glutamyltranspeptidase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ggt2 PE=2 SV=1 31 520 3.0E-107
sp|Q9US04|GGT1_SCHPO Gamma-glutamyltranspeptidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ggt1 PE=2 SV=1 29 549 5.0E-107
sp|P20735|GGT1_PIG Gamma-glutamyltranspeptidase 1 OS=Sus scrofa GN=GGT1 PE=2 SV=1 32 549 3.0E-104
sp|P07314|GGT1_RAT Gamma-glutamyltranspeptidase 1 OS=Rattus norvegicus GN=Ggt1 PE=1 SV=4 24 549 2.0E-103
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B387|GGT1_ARTBC Gamma-glutamyltransferase ARB_02921 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02921 PE=1 SV=1 29 557 0.0E+00
sp|O14194|GGT2_SCHPO Gamma-glutamyltranspeptidase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ggt2 PE=2 SV=1 31 520 3.0E-107
sp|Q9US04|GGT1_SCHPO Gamma-glutamyltranspeptidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ggt1 PE=2 SV=1 29 549 5.0E-107
sp|P20735|GGT1_PIG Gamma-glutamyltranspeptidase 1 OS=Sus scrofa GN=GGT1 PE=2 SV=1 32 549 3.0E-104
sp|P07314|GGT1_RAT Gamma-glutamyltranspeptidase 1 OS=Rattus norvegicus GN=Ggt1 PE=1 SV=4 24 549 2.0E-103
sp|P19440|GGT1_HUMAN Gamma-glutamyltranspeptidase 1 OS=Homo sapiens GN=GGT1 PE=1 SV=2 32 549 3.0E-101
sp|Q680I5|GAGT2_ARATH Gamma-glutamyltranspeptidase 2 OS=Arabidopsis thaliana GN=GGT2 PE=2 SV=1 31 503 4.0E-101
sp|Q60928|GGT1_MOUSE Gamma-glutamyltranspeptidase 1 OS=Mus musculus GN=Ggt1 PE=1 SV=1 24 549 1.0E-98
sp|A6NGU5|GGT3_HUMAN Putative gamma-glutamyltranspeptidase 3 OS=Homo sapiens GN=GGT3P PE=5 SV=2 32 549 6.0E-95
sp|P36268|GGT2_HUMAN Inactive gamma-glutamyltranspeptidase 2 OS=Homo sapiens GN=GGT2 PE=1 SV=3 32 539 2.0E-92
sp|Q8VYW6|GAGT1_ARATH Gamma-glutamyltranspeptidase 1 OS=Arabidopsis thaliana GN=GGT1 PE=2 SV=1 4 503 4.0E-90
sp|Q9M0G0|GAGT3_ARATH Gamma-glutamyltranspeptidase 3 OS=Arabidopsis thaliana GN=GGT3 PE=2 SV=1 31 503 5.0E-90
sp|P18956|GGT_ECOLI Gamma-glutamyltranspeptidase OS=Escherichia coli (strain K12) GN=ggt PE=1 SV=1 29 548 3.0E-83
sp|P36267|GGT_PSEUA Gamma-glutamyltranspeptidase OS=Pseudomonas sp. (strain A14) GN=ggt PE=1 SV=1 7 502 1.0E-79
sp|Q9I406|GGT_PSEAE Gamma-glutamyltranspeptidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ggt PE=3 SV=1 31 548 1.0E-72
sp|Q05902|ECM38_YEAST Gamma-glutamyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM38 PE=1 SV=1 31 502 1.0E-61
sp|P15557|PAC1_PSES3 Acylase ACY 1 OS=Pseudomonas sp. (strain SE83) GN=acyI PE=1 SV=2 31 556 1.0E-59
sp|Q05053|PAC1_PSESV Acylase ACY 1 OS=Pseudomonas sp. (strain V22) GN=acyI PE=1 SV=2 19 556 8.0E-59
sp|Q9UJ14|GGT7_HUMAN Gamma-glutamyltransferase 7 OS=Homo sapiens GN=GGT7 PE=1 SV=2 31 557 7.0E-58
sp|Q9QWE9|GGT5_RAT Gamma-glutamyltransferase 5 OS=Rattus norvegicus GN=Ggt5 PE=2 SV=1 32 491 1.0E-57
sp|Q0V8L2|GGT7_BOVIN Gamma-glutamyltransferase 7 OS=Bos taurus GN=GGT7 PE=2 SV=1 31 557 2.0E-57
sp|Q99MZ4|GGT7_RAT Gamma-glutamyltransferase 7 OS=Rattus norvegicus GN=Ggt7 PE=1 SV=2 31 557 7.0E-57
sp|P36269|GGT5_HUMAN Gamma-glutamyltransferase 5 OS=Homo sapiens GN=GGT5 PE=1 SV=2 36 491 6.0E-56
sp|Q99JP7|GGT7_MOUSE Gamma-glutamyltransferase 7 OS=Mus musculus GN=Ggt7 PE=1 SV=2 31 557 2.0E-55
sp|P54422|GGT_BACSU Gamma-glutamyltranspeptidase OS=Bacillus subtilis (strain 168) GN=ggt PE=1 SV=1 29 557 7.0E-55
sp|Q9Z2A9|GGT5_MOUSE Gamma-glutamyltransferase 5 OS=Mus musculus GN=Ggt5 PE=1 SV=2 32 491 1.0E-53
sp|P63186|GGT_BACNA Gamma-glutamyltranspeptidase OS=Bacillus subtilis subsp. natto GN=ggt PE=1 SV=1 29 542 2.0E-52
sp|Q9BX51|GGTL1_HUMAN Gamma-glutamyltransferase light chain 1 OS=Homo sapiens GN=GGTLC1 PE=2 SV=2 330 549 2.0E-35
sp|P74181|GGT_SYNY3 Gamma-glutamyltranspeptidase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ggt PE=3 SV=1 31 557 2.0E-33
sp|B5MD39|GGTL3_HUMAN Putative gamma-glutamyltransferase light chain 3 OS=Homo sapiens GN=GGTLC3 PE=5 SV=1 330 549 2.0E-32
sp|Q9CAR5|GAGT4_ARATH Putative inactive gamma-glutamyltranspeptidase 4 OS=Arabidopsis thaliana GN=GGT4 PE=5 SV=1 312 503 4.0E-32
sp|Q51693|CAPD_BACAN Capsule biosynthesis protein CapD OS=Bacillus anthracis GN=capD PE=1 SV=2 32 463 7.0E-32
sp|Q14390|GGTL2_HUMAN Gamma-glutamyltransferase light chain 2 OS=Homo sapiens GN=GGTLC2 PE=2 SV=4 330 549 1.0E-25
sp|O05218|YWRD_BACSU Putative gamma-glutamyltransferase YwrD OS=Bacillus subtilis (strain 168) GN=ywrD PE=1 SV=1 33 489 4.0E-25
sp|A7YWM1|GGT6_BOVIN Gamma-glutamyltransferase 6 OS=Bos taurus GN=GGT6 PE=2 SV=1 31 173 6.0E-12
sp|Q6IE08|GGT6_RAT Gamma-glutamyltransferase 6 OS=Rattus norvegicus GN=Ggt6 PE=2 SV=1 32 219 2.0E-11
sp|Q6PDE7|GGT6_MOUSE Gamma-glutamyltransferase 6 OS=Mus musculus GN=Ggt6 PE=2 SV=1 32 173 1.0E-10
sp|Q6P531|GGT6_HUMAN Gamma-glutamyltransferase 6 OS=Homo sapiens GN=GGT6 PE=2 SV=2 33 173 8.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6609
MAPLLRLASSLLFLSAATLAAYDPEQPPKIGAVASESAVCSQIGRQLLKIGGNAADAMLGTVLCVGIVAMYHSGI
GGGGFMTIRLPNGTYESVDFRETAPAAAFESMFEDNVEASKVGGLASGVPGELRGLDYLHRKYGKLPWVQVFQPI
IKLARAGFVVTEELARFMDAQKTPFLTDDPAWAVDFAPQGKRVQKADIMTRKRYANTLEDIANYGVDVFYTGAMA
KATVAAVQARNGIMTMADLANYTVKHREAVHVEYRGHKLTSCNTPASGVVALSALNIVSGYEPLDNMGALSTHRL
DEAFKFAFGQRVNLGDPDFVAGMDEYTAKMISPQTGASLRSRISNATTHEPDWYDSERLEVPEMAGTSFIATADA
SGMAIALTTSLNLGFGSRVMVPETGIVMNSQMNDFGIPGSSDAYGYKASAANLVGPGKRPLSSISPVIGETPDGR
LSFSVGGAGGSRIITATAQAIVHLIDQQMSMLEALKQPRLHDQLIPSVVTFEDGFDNKTVDFMRRLHHNVSWVAP
GQSSVQGVRQLPNGTFEAAGEPRQASSGGFAI*
Coding >OphauG2|6609
ATGGCGCCTCTACTCAGACTGGCGAGCAGCCTGCTCTTCCTCTCGGCAGCCACACTCGCGGCATACGACCCCGAA
CAGCCGCCCAAGATTGGGGCCGTGGCCTCGGAGAGTGCTGTGTGTAGCCAAATCGGCAGGCAGCTGCTAAAGATT
GGCGGCAACGCGGCAGACGCCATGTTGGGCACGGTGCTCTGTGTGGGCATTGTGGCCATGTATCATAGCGGCATC
GGAGGCGGAGGCTTCATGACGATACGCTTGCCAAACGGGACGTATGAGAGTGTCGATTTTCGAGAGACGGCGCCG
GCGGCGGCGTTTGAGAGCATGTTTGAGGATAATGTCGAGGCCAGCAAGGTGGGGGGGCTTGCGAGCGGCGTGCCA
GGAGAGCTAAGAGGACTCGACTACCTTCACAGAAAGTACGGAAAGCTGCCCTGGGTCCAAGTCTTCCAGCCCATC
ATCAAGCTGGCACGCGCCGGCTTCGTCGTGACTGAGGAACTGGCCAGATTCATGGATGCCCAAAAGACGCCCTTT
TTGACCGACGACCCGGCCTGGGCAGTCGACTTTGCGCCCCAGGGCAAACGAGTGCAAAAGGCGGACATTATGACA
CGCAAACGCTACGCCAATACTCTTGAAGACATTGCCAACTATGGCGTCGACGTCTTTTACACTGGAGCCATGGCC
AAGGCAACAGTTGCCGCCGTCCAGGCTCGCAACGGCATCATGACAATGGCCGACCTGGCAAACTATACCGTCAAG
CACAGGGAGGCTGTGCATGTGGAATACCGCGGCCATAAGCTGACAAGCTGCAACACACCAGCGAGCGGAGTGGTG
GCTCTGAGTGCCCTGAATATTGTGAGTGGTTATGAGCCGCTGGACAACATGGGCGCCTTGTCGACGCATCGGCTC
GACGAGGCCTTCAAGTTTGCATTTGGGCAGCGAGTAAACCTGGGCGATCCGGATTTTGTGGCCGGCATGGACGAG
TATACGGCCAAGATGATTTCGCCGCAAACAGGGGCGTCTCTCCGCTCGCGGATTTCCAACGCGACAACACATGAG
CCGGACTGGTACGACTCGGAGAGACTCGAGGTCCCCGAGATGGCTGGCACATCCTTCATCGCGACAGCCGATGCC
AGCGGAATGGCCATAGCGCTGACGACGTCGCTCAACCTCGGCTTCGGGTCCCGCGTCATGGTTCCCGAGACTGGC
ATCGTCATGAACAGCCAGATGAACGACTTTGGCATCCCGGGCAGCTCGGATGCCTACGGCTACAAGGCCAGCGCG
GCCAATCTTGTGGGACCGGGCAAACGGCCGCTGTCATCGATTTCGCCCGTGATTGGCGAGACGCCCGACGGCCGC
CTGTCGTTTAGTGTGGGAGGCGCGGGAGGCAGCCGCATCATCACGGCCACGGCACAGGCCATTGTGCACTTGATT
GATCAACAGATGAGCATGCTGGAGGCGCTAAAGCAGCCACGGTTGCACGACCAGCTGATACCCAGTGTGGTGACG
TTTGAGGACGGGTTTGACAACAAGACGGTGGATTTCATGAGGCGGCTGCACCACAATGTGTCGTGGGTGGCGCCG
GGACAGAGTTCTGTGCAGGGGGTGCGGCAGTTGCCAAATGGGACGTTTGAAGCGGCTGGAGAGCCGAGACAGGCG
AGCTCGGGGGGGTTTGCAATCTAG
Transcript >OphauG2|6609
ATGGCGCCTCTACTCAGACTGGCGAGCAGCCTGCTCTTCCTCTCGGCAGCCACACTCGCGGCATACGACCCCGAA
CAGCCGCCCAAGATTGGGGCCGTGGCCTCGGAGAGTGCTGTGTGTAGCCAAATCGGCAGGCAGCTGCTAAAGATT
GGCGGCAACGCGGCAGACGCCATGTTGGGCACGGTGCTCTGTGTGGGCATTGTGGCCATGTATCATAGCGGCATC
GGAGGCGGAGGCTTCATGACGATACGCTTGCCAAACGGGACGTATGAGAGTGTCGATTTTCGAGAGACGGCGCCG
GCGGCGGCGTTTGAGAGCATGTTTGAGGATAATGTCGAGGCCAGCAAGGTGGGGGGGCTTGCGAGCGGCGTGCCA
GGAGAGCTAAGAGGACTCGACTACCTTCACAGAAAGTACGGAAAGCTGCCCTGGGTCCAAGTCTTCCAGCCCATC
ATCAAGCTGGCACGCGCCGGCTTCGTCGTGACTGAGGAACTGGCCAGATTCATGGATGCCCAAAAGACGCCCTTT
TTGACCGACGACCCGGCCTGGGCAGTCGACTTTGCGCCCCAGGGCAAACGAGTGCAAAAGGCGGACATTATGACA
CGCAAACGCTACGCCAATACTCTTGAAGACATTGCCAACTATGGCGTCGACGTCTTTTACACTGGAGCCATGGCC
AAGGCAACAGTTGCCGCCGTCCAGGCTCGCAACGGCATCATGACAATGGCCGACCTGGCAAACTATACCGTCAAG
CACAGGGAGGCTGTGCATGTGGAATACCGCGGCCATAAGCTGACAAGCTGCAACACACCAGCGAGCGGAGTGGTG
GCTCTGAGTGCCCTGAATATTGTGAGTGGTTATGAGCCGCTGGACAACATGGGCGCCTTGTCGACGCATCGGCTC
GACGAGGCCTTCAAGTTTGCATTTGGGCAGCGAGTAAACCTGGGCGATCCGGATTTTGTGGCCGGCATGGACGAG
TATACGGCCAAGATGATTTCGCCGCAAACAGGGGCGTCTCTCCGCTCGCGGATTTCCAACGCGACAACACATGAG
CCGGACTGGTACGACTCGGAGAGACTCGAGGTCCCCGAGATGGCTGGCACATCCTTCATCGCGACAGCCGATGCC
AGCGGAATGGCCATAGCGCTGACGACGTCGCTCAACCTCGGCTTCGGGTCCCGCGTCATGGTTCCCGAGACTGGC
ATCGTCATGAACAGCCAGATGAACGACTTTGGCATCCCGGGCAGCTCGGATGCCTACGGCTACAAGGCCAGCGCG
GCCAATCTTGTGGGACCGGGCAAACGGCCGCTGTCATCGATTTCGCCCGTGATTGGCGAGACGCCCGACGGCCGC
CTGTCGTTTAGTGTGGGAGGCGCGGGAGGCAGCCGCATCATCACGGCCACGGCACAGGCCATTGTGCACTTGATT
GATCAACAGATGAGCATGCTGGAGGCGCTAAAGCAGCCACGGTTGCACGACCAGCTGATACCCAGTGTGGTGACG
TTTGAGGACGGGTTTGACAACAAGACGGTGGATTTCATGAGGCGGCTGCACCACAATGTGTCGTGGGTGGCGCCG
GGACAGAGTTCTGTGCAGGGGGTGCGGCAGTTGCCAAATGGGACGTTTGAAGCGGCTGGAGAGCCGAGACAGGCG
AGCTCGGGGGGGTTTGCAATCTAG
Gene >OphauG2|6609
ATGGCGCCTCTACTCAGACTGGCGAGCAGCCTGCTCTTCCTCTCGGCAGCCACACTCGCGGCATACGACCCCGAA
CAGCCGCCCAAGATTGGGGCCGTGGCCTCGGAGAGTGCTGTGTGTAGCCAAATCGGCAGGCAGCTGCTAAAGATT
GGCGGCAACGCGGCAGACGCCATGTTGGGCACGGTGCTCTGTGTGGGCATTGTGGCCATGTATCATAGCGGCATC
GGAGGCGGAGGCTTCATGACGATACGCTTGCCAAACGGGACGTATGAGAGTGTCGATTTTCGAGAGACGGCGCCG
GCGGCGGCGTTTGAGAGCATGTTTGAGGATAATGTCGAGGCCAGCAAGGTGGGGGGGCTTGCGAGGTGAGTTGAA
ATTATATCCTGCTATTGCAACATATTTCTTTCTTTTTGGCATGGTCATGTATATCCCTTTACTACCTACAATGTA
TCCCTTTCTTTTTGGCATGGTCGAGTAAAAGAAATGCTTCGACTAACTGTAAAGGACGCAGCGGCGTGCCAGGAG
AGCTAAGAGGACTCGACTACCTTCACAGAAAGTACGGAAAGCTGCCCTGGGTCCAAGTCTTCCAGCCCATCATCA
AGCTGGCACGCGCCGGCTTCGTCGTGACTGAGGAACTGGCCAGATTCATGGATGCCCAAAAGACGCCCTTTTTGA
CCGACGACCCGGCCTGGGCAGTCGACTTTGCGCCCCAGGGCAAACGAGTGCAAAAGGCGGACATTATGACACGCA
AACGCTACGCCAATACTCTTGAAGACATTGCCAACTATGGCGTCGACGTCTTTTACACTGGAGCCATGGCCAAGG
CAACAGTTGCCGCCGTCCAGGCTCGCAACGGCATCATGACAATGGCCGACCTGGCAAACTATACCGTCAAGCACA
GGGAGGCTGTGCATGTGGAATACCGCGGCCATAAGCTGACAAGCTGCAACACACCAGCGAGCGGAGTGGTGGCTC
TGAGTGCCCTGAATATTGTGAGTGGTTATGAGCCGCTGGACAACATGGGCGCCTTGTCGACGCATCGGCTCGACG
AGGCCTTCAAGTTTGCATTTGGGCAGCGAGTAAACCTGGGCGATCCGGATTTTGTGGCCGGCATGGACGAGTATA
CGGCCAAGATGATTTCGCCGCAAACAGGGGCGTCTCTCCGCTCGCGGATTTCCAACGCGACAACACATGAGCCGG
ACTGGTACGACTCGGAGAGACTCGAGGTCCCCGAGATGGCTGGCACATCCTTCATCGCGACAGCCGATGCCAGCG
GAATGGCCATAGCGCTGACGACGTCGCTCAACCTCGGCTTCGGGTCCCGCGTCATGGTTCCCGAGACTGGCATCG
TCATGAACAGCCAGATGAACGACTTTGGCATCCCGGGCAGCTCGGATGCCTACGGCTACAAGGCCAGCGCGGCCA
ATCTTGTGGGACCGGGCAAACGGCCGCTGTCATCGATTTCGCCCGTGATTGGCGAGACGCCCGACGGCCGCCTGT
CGTTTAGTGTGGGAGGCGCGGGAGGCAGCCGCATCATCACGGCCACGGCACAGGCCATTGTGCACTTGATTGATC
AACAGATGAGCATGCTGGAGGCGCTAAAGCAGCCACGGTTGCACGACCAGCTGATACCCAGTGTGGTGACGTTTG
AGGACGGGTTTGACAACAAGACGGTGGATTTCATGAGGCGGCTGCACCACAATGTGTCGTGGGTGGCGCCGGGAC
AGAGTTCTGTGCAGGGGGTGCGGCAGTTGCCAAATGGGACGTTTGAAGCGGCTGGAGAGCCGAGACAGGCGAGCT
CGGGGGGGTTTGCAATCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail