Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6603
Gene name
LocationContig_696:6753..9724
Strand+
Gene length (bp)2971
Transcript length (bp)2631
Coding sequence length (bp)2631
Protein length (aa) 877

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10291 muHD Muniscin C-terminal mu homology domain 1.8E-64 605 875
PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain 8.3E-08 22 93

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43059|SYP1_SCHPO Cytoskeletal protein syp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syp1 PE=1 SV=1 3 643 5.0E-13
sp|Q0JRZ9|FCHO2_HUMAN F-BAR domain only protein 2 OS=Homo sapiens GN=FCHO2 PE=1 SV=2 609 785 2.0E-07
sp|Q5R807|FCHO2_PONAB F-BAR domain only protein 2 OS=Pongo abelii GN=FCHO2 PE=2 SV=1 609 785 3.0E-07
sp|D3ZYR1|FCHO2_RAT F-BAR domain only protein 2 OS=Rattus norvegicus GN=Fcho2 PE=1 SV=1 609 785 4.0E-07
sp|Q3UQN2|FCHO2_MOUSE F-BAR domain only protein 2 OS=Mus musculus GN=Fcho2 PE=1 SV=1 609 785 4.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43059|SYP1_SCHPO Cytoskeletal protein syp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syp1 PE=1 SV=1 3 643 5.0E-13
sp|Q0JRZ9|FCHO2_HUMAN F-BAR domain only protein 2 OS=Homo sapiens GN=FCHO2 PE=1 SV=2 609 785 2.0E-07
sp|Q5R807|FCHO2_PONAB F-BAR domain only protein 2 OS=Pongo abelii GN=FCHO2 PE=2 SV=1 609 785 3.0E-07
sp|D3ZYR1|FCHO2_RAT F-BAR domain only protein 2 OS=Rattus norvegicus GN=Fcho2 PE=1 SV=1 609 785 4.0E-07
sp|Q3UQN2|FCHO2_MOUSE F-BAR domain only protein 2 OS=Mus musculus GN=Fcho2 PE=1 SV=1 609 785 4.0E-07
sp|Q502I9|FCHO2_DANRE F-BAR domain only protein 2 OS=Danio rerio GN=fcho2 PE=2 SV=1 19 233 6.0E-07
sp|P25623|SYP1_YEAST Suppressor of yeast profilin deletion OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SYP1 PE=1 SV=3 1 234 8.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup538
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6603 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|8106
Ophiocordyceps camponoti-floridani Ophcf2|06279
Ophiocordyceps camponoti-rufipedis Ophun1|3074
Ophiocordyceps camponoti-rufipedis Ophun1|4973
Ophiocordyceps kimflemingae Ophio5|1721
Ophiocordyceps subramaniannii Hirsu2|3612
Ophiocordyceps subramaniannii Hirsu2|4185

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6603
MEVSRAEYPGMLAHLQPGSAVTILNERVKHINKINIEIADWLQERRRVEEQYALGLRKLAQFRVPNSVSDLGVFQ
TPWTRVIESVKRMAQSHHVLAERIEVDVEHQLRAYQQRRDYQNMQNISLNLSSMAKDLVEAQERSEKLGRKGAKA
SGQKLDAATSKLESATQQWESQAPFIFETLQALDESRVNQLRDLLTQYQTLETDQAQRTQNNAVETLAAMLEIST
EREIQSFSQRTIRDKPVTSARMVMRRSSTAMAAPERAATPTQPLPASPFPANATAPTPAQQPVNPTALTEDDTAS
ENNSAPADSKSESKLRRLGTMLSNRRRQSIVGFGSFATSKHTPSPFGRLGSSHSHGRNISPRPSSSNLHQDSTRL
SSLAETPDQPNAHDATGRQPEHWGANGVLARSHSSASATHRNGTRLGDATNVTPPPQGPPAALSADATPALAQDS
EGFTIRAPMNDPISEAQREAANDEADQLFKLNIKNNPVDEEDPEAKQAALSSVANTLKMGPATRRSSTLRGRRDM
RNTIYAPAPNSSIPESVLSSAIPSLAGSPPATSSSFSKPPAIAALASEASGTGTSDTQSIRSGNSLGSLVHAKHP
ELTGPGLNVSVVESVSAMFEDGQATHVSIGGEIAFSHNSSSSTKSHEVIRINNFSRLERISPNRIFVHNASPDQP
DQFSLDLSHLSKTTIGFSYRLLADDAHESAALVQHAPLLLKPVWKPQGDKLGLLLQYRLNPAATAFAGPVTLHNV
VFVVTYEGRASGAQTKPSGTHLKDKHIVYWRLGDLELTPDMQKLVCRIVGLEGVAPLPGHVEARWEYAAPGNEAL
GSGISISKLQEEKGKAVEASEDDPFADQSVNQSWLDVSLQRKLVSGKYEAK*
Coding >OphauG2|6603
ATGGAAGTGTCAAGGGCCGAGTATCCCGGCATGCTGGCTCATTTGCAGCCAGGCTCGGCCGTCACCATACTCAAC
GAGAGGGTCAAGCACATCAACAAGATTAATATCGAAATTGCAGACTGGCTTCAGGAACGACGCCGCGTCGAGGAG
CAGTATGCTCTAGGCTTGCGCAAACTGGCCCAATTCCGGGTCCCCAATTCTGTATCCGATCTCGGCGTCTTCCAG
ACGCCTTGGACCAGAGTAATCGAGTCGGTCAAGCGCATGGCACAATCCCATCACGTCCTGGCCGAGCGCATCGAA
GTAGACGTCGAGCATCAACTTCGCGCCTACCAGCAACGGCGCGACTATCAAAACATGCAGAACATCTCCCTCAAT
CTCTCTTCAATGGCTAAGGACCTTGTCGAGGCGCAGGAGAGGTCGGAGAAACTAGGCAGAAAGGGCGCCAAGGCA
AGCGGACAAAAACTGGACGCTGCCACTTCAAAGCTCGAGTCGGCCACACAGCAGTGGGAATCCCAGGCCCCCTTC
ATCTTTGAGACGCTCCAAGCCCTGGATGAATCCCGTGTCAACCAGCTACGTGACCTGTTGACGCAGTACCAGACG
CTCGAGACGGATCAAGCGCAACGGACACAGAATAACGCTGTTGAAACGCTGGCCGCCATGCTCGAGATTTCAACC
GAAAGGGAAATTCAGTCATTTTCACAACGGACAATCCGTGACAAGCCTGTGACTTCTGCGAGAATGGTCATGAGA
CGTTCGTCTACCGCCATGGCTGCGCCAGAACGTGCTGCCACGCCGACCCAGCCACTTCCAGCCTCACCTTTTCCA
GCAAATGCGACGGCCCCAACACCCGCTCAGCAGCCAGTGAACCCTACAGCCCTGACCGAAGATGATACGGCAAGC
GAAAACAACTCGGCACCGGCAGACTCGAAATCAGAATCCAAATTGCGGCGCCTCGGAACCATGCTGAGCAATCGG
CGGCGACAGAGCATCGTTGGCTTCGGGTCCTTTGCCACTTCCAAGCACACCCCCTCTCCCTTTGGCCGGTTGGGC
AGTAGCCATAGTCACGGCCGCAACATATCGCCCCGGCCGTCGTCGAGCAATCTCCACCAAGACTCGACTCGCCTT
TCTTCTCTCGCTGAGACACCCGACCAGCCCAACGCACACGATGCCACTGGGCGCCAGCCCGAGCATTGGGGCGCC
AATGGTGTTCTGGCCCGCAGCCACTCATCTGCCTCTGCTACACACCGCAACGGAACCCGCCTCGGCGATGCAACC
AATGTCACCCCTCCTCCTCAAGGCCCGCCTGCAGCACTGTCGGCCGACGCAACGCCCGCCTTGGCCCAGGATTCC
GAAGGCTTCACGATACGCGCGCCCATGAACGACCCCATCTCCGAGGCACAGCGCGAAGCTGCGAATGACGAGGCC
GACCAGCTCTTCAAGCTCAACATCAAGAACAATCCAGTAGACGAGGAAGACCCCGAGGCCAAGCAAGCCGCACTG
TCCAGCGTAGCAAATACACTCAAGATGGGTCCAGCCACGCGTCGTTCCAGCACCTTGCGAGGTCGCCGCGACATG
CGCAATACTATTTACGCTCCCGCCCCCAATTCGAGTATACCCGAGAGCGTCCTAAGCAGTGCTATTCCGTCCCTT
GCCGGCTCTCCTCCAGCGACGTCTTCGTCGTTTTCAAAGCCCCCCGCAATAGCCGCACTGGCTTCCGAGGCTAGC
GGGACGGGAACGTCTGATACGCAATCCATTCGGTCGGGCAACTCGTTGGGCAGTCTAGTTCATGCCAAGCATCCC
GAACTTACGGGCCCTGGCCTCAATGTGTCCGTCGTTGAGAGTGTTTCCGCCATGTTTGAGGATGGCCAGGCCACA
CACGTTTCGATTGGAGGGGAAATTGCATTTTCACACAATTCATCTAGTAGCACCAAGAGTCATGAGGTGATTCGC
ATCAATAATTTTTCAAGGCTGGAGCGCATCAGCCCCAACCGCATATTCGTTCACAATGCTTCTCCAGATCAGCCC
GACCAATTCTCATTGGATCTTTCTCATCTCTCAAAGACGACGATTGGTTTTTCATATCGGTTACTTGCAGACGAC
GCCCACGAGTCGGCTGCGCTCGTGCAGCATGCTCCACTGCTCCTCAAGCCAGTTTGGAAGCCACAGGGCGATAAG
CTTGGTCTTTTGCTACAATACCGGCTCAACCCGGCAGCCACGGCCTTTGCAGGGCCCGTGACGCTGCACAACGTT
GTCTTTGTCGTGACGTATGAAGGAAGAGCAAGCGGCGCTCAAACAAAGCCCAGTGGCACGCATTTGAAGGATAAG
CATATTGTCTACTGGCGCCTGGGCGACTTGGAGCTCACGCCTGACATGCAGAAGCTGGTTTGCCGCATCGTTGGA
CTGGAAGGTGTTGCGCCGCTGCCGGGGCATGTCGAGGCAAGATGGGAGTACGCGGCTCCTGGAAACGAGGCCCTT
GGGAGTGGCATTTCCATTTCGAAGCTGCAAGAGGAAAAGGGCAAAGCGGTTGAGGCCTCTGAGGACGATCCATTT
GCGGACCAGAGCGTGAATCAGAGCTGGTTGGATGTTTCGCTTCAACGAAAATTAGTAAGTGGTAAGTATGAGGCG
AAGTGA
Transcript >OphauG2|6603
ATGGAAGTGTCAAGGGCCGAGTATCCCGGCATGCTGGCTCATTTGCAGCCAGGCTCGGCCGTCACCATACTCAAC
GAGAGGGTCAAGCACATCAACAAGATTAATATCGAAATTGCAGACTGGCTTCAGGAACGACGCCGCGTCGAGGAG
CAGTATGCTCTAGGCTTGCGCAAACTGGCCCAATTCCGGGTCCCCAATTCTGTATCCGATCTCGGCGTCTTCCAG
ACGCCTTGGACCAGAGTAATCGAGTCGGTCAAGCGCATGGCACAATCCCATCACGTCCTGGCCGAGCGCATCGAA
GTAGACGTCGAGCATCAACTTCGCGCCTACCAGCAACGGCGCGACTATCAAAACATGCAGAACATCTCCCTCAAT
CTCTCTTCAATGGCTAAGGACCTTGTCGAGGCGCAGGAGAGGTCGGAGAAACTAGGCAGAAAGGGCGCCAAGGCA
AGCGGACAAAAACTGGACGCTGCCACTTCAAAGCTCGAGTCGGCCACACAGCAGTGGGAATCCCAGGCCCCCTTC
ATCTTTGAGACGCTCCAAGCCCTGGATGAATCCCGTGTCAACCAGCTACGTGACCTGTTGACGCAGTACCAGACG
CTCGAGACGGATCAAGCGCAACGGACACAGAATAACGCTGTTGAAACGCTGGCCGCCATGCTCGAGATTTCAACC
GAAAGGGAAATTCAGTCATTTTCACAACGGACAATCCGTGACAAGCCTGTGACTTCTGCGAGAATGGTCATGAGA
CGTTCGTCTACCGCCATGGCTGCGCCAGAACGTGCTGCCACGCCGACCCAGCCACTTCCAGCCTCACCTTTTCCA
GCAAATGCGACGGCCCCAACACCCGCTCAGCAGCCAGTGAACCCTACAGCCCTGACCGAAGATGATACGGCAAGC
GAAAACAACTCGGCACCGGCAGACTCGAAATCAGAATCCAAATTGCGGCGCCTCGGAACCATGCTGAGCAATCGG
CGGCGACAGAGCATCGTTGGCTTCGGGTCCTTTGCCACTTCCAAGCACACCCCCTCTCCCTTTGGCCGGTTGGGC
AGTAGCCATAGTCACGGCCGCAACATATCGCCCCGGCCGTCGTCGAGCAATCTCCACCAAGACTCGACTCGCCTT
TCTTCTCTCGCTGAGACACCCGACCAGCCCAACGCACACGATGCCACTGGGCGCCAGCCCGAGCATTGGGGCGCC
AATGGTGTTCTGGCCCGCAGCCACTCATCTGCCTCTGCTACACACCGCAACGGAACCCGCCTCGGCGATGCAACC
AATGTCACCCCTCCTCCTCAAGGCCCGCCTGCAGCACTGTCGGCCGACGCAACGCCCGCCTTGGCCCAGGATTCC
GAAGGCTTCACGATACGCGCGCCCATGAACGACCCCATCTCCGAGGCACAGCGCGAAGCTGCGAATGACGAGGCC
GACCAGCTCTTCAAGCTCAACATCAAGAACAATCCAGTAGACGAGGAAGACCCCGAGGCCAAGCAAGCCGCACTG
TCCAGCGTAGCAAATACACTCAAGATGGGTCCAGCCACGCGTCGTTCCAGCACCTTGCGAGGTCGCCGCGACATG
CGCAATACTATTTACGCTCCCGCCCCCAATTCGAGTATACCCGAGAGCGTCCTAAGCAGTGCTATTCCGTCCCTT
GCCGGCTCTCCTCCAGCGACGTCTTCGTCGTTTTCAAAGCCCCCCGCAATAGCCGCACTGGCTTCCGAGGCTAGC
GGGACGGGAACGTCTGATACGCAATCCATTCGGTCGGGCAACTCGTTGGGCAGTCTAGTTCATGCCAAGCATCCC
GAACTTACGGGCCCTGGCCTCAATGTGTCCGTCGTTGAGAGTGTTTCCGCCATGTTTGAGGATGGCCAGGCCACA
CACGTTTCGATTGGAGGGGAAATTGCATTTTCACACAATTCATCTAGTAGCACCAAGAGTCATGAGGTGATTCGC
ATCAATAATTTTTCAAGGCTGGAGCGCATCAGCCCCAACCGCATATTCGTTCACAATGCTTCTCCAGATCAGCCC
GACCAATTCTCATTGGATCTTTCTCATCTCTCAAAGACGACGATTGGTTTTTCATATCGGTTACTTGCAGACGAC
GCCCACGAGTCGGCTGCGCTCGTGCAGCATGCTCCACTGCTCCTCAAGCCAGTTTGGAAGCCACAGGGCGATAAG
CTTGGTCTTTTGCTACAATACCGGCTCAACCCGGCAGCCACGGCCTTTGCAGGGCCCGTGACGCTGCACAACGTT
GTCTTTGTCGTGACGTATGAAGGAAGAGCAAGCGGCGCTCAAACAAAGCCCAGTGGCACGCATTTGAAGGATAAG
CATATTGTCTACTGGCGCCTGGGCGACTTGGAGCTCACGCCTGACATGCAGAAGCTGGTTTGCCGCATCGTTGGA
CTGGAAGGTGTTGCGCCGCTGCCGGGGCATGTCGAGGCAAGATGGGAGTACGCGGCTCCTGGAAACGAGGCCCTT
GGGAGTGGCATTTCCATTTCGAAGCTGCAAGAGGAAAAGGGCAAAGCGGTTGAGGCCTCTGAGGACGATCCATTT
GCGGACCAGAGCGTGAATCAGAGCTGGTTGGATGTTTCGCTTCAACGAAAATTAGTAAGTGGTAAGTATGAGGCG
AAGTGA
Gene >OphauG2|6603
ATGGAAGTGTCAAGGGCCGAGTATCCCGGCATGCTGGTAAGCCTCAGGGAGCCCCGTTAGCCCATCTAACGCTCC
GTTGTTAACTGTTGCGCTTGCTTGTCGCCCTCTTGACTAGGCTCATTTGCAGCCAGGCTCGGCCGTCACCATACT
CAACGAGAGGGTCAAGCACATCAACAAGATTAATATCGAAATTGCAGACTGGCTTCAGGTACAGCGCTGACGGAG
CACTGTTTGATGCCCAAGGGCGCCGACTAACATGGCGCAAATCAGGAACGACGCCGCGTCGAGGAGCAGTATGCT
CTAGGCTTGCGCAAACTGGCCCAATTCCGGGTCCCCAATTCTGTATCCGATCTCGGGTGCGCTTGCTTCCCCTCG
GCGCTGGCAAGGACTGACAAAGGTGCTGACGCGCTTCCCCTGACTATGTAGCGTCTTCCAGACGCCTTGGACCAG
AGTAATCGAGTCGGTCAAGCGCATGGCACAATCCCATCACGTCCTGGCCGAGCGCATCGAAGTAGACGTCGAGCA
TCAACTTCGCGCCTACCAGCAACGGCGCGACTATCAAAACATGCAGAACATCTCCCTCAATCTCTCTTCAATGGC
TAAGGACCTTGTCGAGGCGCAGGAGAGGTCGGAGAAACTAGGCAGAAAGGGCGCCAAGGCAAGCGGACAAAAACT
GGACGCTGCCACTTCAAAGCTCGAGTCGGCCACACAGCAGTGGGAATCCCAGGCCCCCTTCATCTTTGAGACGCT
CCAAGCCCTGGATGAATCCCGTGTCAACCAGCTACGTGACCTGTTGACGCAGTACCAGACGCTCGAGACGGATCA
AGCGCAACGGACACAGAATAACGCTGTTGAAACGCTGGCCGCCATGCTCGAGATTTCAACCGAAAGGGAAATTCA
GTCATTTTCACAACGGACAATCCGTGACAAGCCTGTGACTTCTGCGAGAATGGTCATGAGACGTTCGTCTACCGC
CATGGCTGCGCCAGAACGTGCTGCCACGCCGACCCAGCCACTTCCAGCCTCACCTTTTCCAGCAAATGCGACGGC
CCCAACACCCGCTCAGCAGCCAGTGAACCCTACAGCCCTGACCGAAGATGATACGGCAAGCGAAAACAACTCGGC
ACCGGCAGACTCGAAATCAGGTAAGCTTGCGCTCGTCCACTCAATTGCGCCATGCTTCAGTGTCTCACAAGCTCC
CAGAATCCAAATTGCGGCGCCTCGGAACCATGCTGAGCAATCGGCGGCGACAGAGCATCGTTGGCTTCGGGTCCT
TTGCCACTTCCAAGCACACCCCCTCTCCCTTTGGCCGGTTGGGCAGTAGCCATAGTCACGGCCGCAACATATCGC
CCCGGCCGTCGTCGAGCAATCTCCACCAAGACTCGACTCGCCTTTCTTCTCTCGCTGAGACACCCGACCAGCCCA
ACGCACACGATGCCACTGGGCGCCAGCCCGAGCATTGGGGCGCCAATGGTGTTCTGGCCCGCAGCCACTCATCTG
CCTCTGCTACACACCGCAACGGAACCCGCCTCGGCGATGCAACCAATGTCACCCCTCCTCCTCAAGGCCCGCCTG
CAGCACTGTCGGCCGACGCAACGCCCGCCTTGGCCCAGGATTCCGAAGGCTTCACGATACGCGCGCCCATGAACG
ACCCCATCTCCGAGGCACAGCGCGAAGCTGCGAATGACGAGGCCGACCAGCTCTTCAAGCTCAACATCAAGAACA
ATCCAGTAGACGAGGAAGACCCCGAGGCCAAGCAAGCCGCACTGTCCAGCGTAGCAAATACACTCAAGATGGGTC
CAGCCACGCGTCGTTCCAGCACCTTGCGAGGTCGCCGCGACATGCGCAATACTATTTACGCTCCCGCCCCCAATT
CGAGTATACCCGAGAGCGTCCTAAGCAGTGCTATTCCGTCCCTTGCCGGCTCTCCTCCAGCGACGTCTTCGTCGT
TTTCAAAGCCCCCCGCAATAGCCGCACTGGCTTCCGAGGCTAGCGGGACGGGAACGTCTGATACGCAATCCATTC
GGTCGGGCAACTCGTTGGGCAGTCTAGTTCATGCCAAGCATCCCGAACTTACGGGCCCTGGCCTCAATGTGTCCG
TCGTTGAGAGTGTTTCCGCCATGTTTGAGGATGGCCAGGCCACACACGTTTCGATTGGAGGGGAAATTGCATTTT
CACACAATTCATCTAGTAGCACCAAGAGTAAGCAAAAAAAAAAAAGGCTCCGTTACTAGGCGTCTACAGTCTTTC
AAGGTCGCTGACGTGGTATATAGGTCATGAGGTGATTCGCATCAATAATTTTTCAAGGCTGGAGCGCATCAGCCC
CAACCGCATATTCGTTCACAATGCTTCTCCAGATCAGCCCGACCAATTCTCATTGGATCTTTCTCATCTCTCAAA
GACGACGATTGGTTTTTCATATCGGTTACTTGCAGACGACGCCCACGAGTCGGCTGCGCTCGTGCAGCATGCTCC
ACTGCTCCTCAAGCCAGTTTGGAAGCCACAGGGCGATAAGCTTGGTCTTTTGCTACAATACCGGCTCAACCCGGC
AGCCACGGCCTTTGCAGGGCCCGTGACGCTGCACAACGTTGTCTTTGTCGTGACGTATGAAGGAAGAGCAAGCGG
CGCTCAAACAAAGCCCAGTGGCACGCATTTGAAGGATAAGCATATTGTCTACTGGCGCCTGGGCGACTTGGAGCT
CACGCCTGACATGCAGAAGCTGGTTTGCCGCATCGTTGGACTGGAAGGTGTTGCGCCGCTGCCGGGGCATGTCGA
GGCAAGATGGGAGTACGCGGCTCCTGGAAACGAGGCCCTTGGGAGTGGCATTTCCATTTCGAAGCTGCAAGAGGA
AAAGGGCAAAGCGGTTGAGGCCTCTGAGGACGATCCATTTGCGGACCAGAGCGTGAATCAGAGCTGGTTGGATGT
TTCGCTTCAACGAAAATTAGTAAGTGGTAAGTATGAGGCGAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail