Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6596
Gene name
LocationContig_694:1690..3229
Strand+
Gene length (bp)1539
Transcript length (bp)1539
Coding sequence length (bp)1539
Protein length (aa) 513

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01416 PseudoU_synth_1 tRNA pseudouridine synthase 1.3E-32 231 363

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q3SX07|PUS3_BOVIN tRNA pseudouridine(38/39) synthase OS=Bos taurus GN=PUS3 PE=2 SV=1 5 421 1.0E-74
sp|Q9JI38|PUS3_MOUSE tRNA pseudouridine(38/39) synthase OS=Mus musculus GN=Pus3 PE=1 SV=2 15 421 2.0E-73
sp|P31115|PUS3_YEAST tRNA pseudouridine(38/39) synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DEG1 PE=1 SV=1 7 482 4.0E-72
sp|Q9BZE2|PUS3_HUMAN tRNA pseudouridine(38/39) synthase OS=Homo sapiens GN=PUS3 PE=1 SV=3 5 421 1.0E-71
sp|Q9UTB3|YL85_SCHPO Putative tRNA pseudouridine synthase C25B8.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.05 PE=3 SV=1 34 490 3.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q3SX07|PUS3_BOVIN tRNA pseudouridine(38/39) synthase OS=Bos taurus GN=PUS3 PE=2 SV=1 5 421 1.0E-74
sp|Q9JI38|PUS3_MOUSE tRNA pseudouridine(38/39) synthase OS=Mus musculus GN=Pus3 PE=1 SV=2 15 421 2.0E-73
sp|P31115|PUS3_YEAST tRNA pseudouridine(38/39) synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DEG1 PE=1 SV=1 7 482 4.0E-72
sp|Q9BZE2|PUS3_HUMAN tRNA pseudouridine(38/39) synthase OS=Homo sapiens GN=PUS3 PE=1 SV=3 5 421 1.0E-71
sp|Q9UTB3|YL85_SCHPO Putative tRNA pseudouridine synthase C25B8.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.05 PE=3 SV=1 34 490 3.0E-66
sp|Q09524|TG124_CAEEL Probable tRNA pseudouridine synthase tag-124 OS=Caenorhabditis elegans GN=tag-124 PE=3 SV=1 41 366 3.0E-48
sp|A0B7V0|TRUA_METTP tRNA pseudouridine synthase A OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=truA PE=3 SV=1 64 338 2.0E-26
sp|O26928|TRUA_METTH tRNA pseudouridine synthase A OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=truA PE=3 SV=1 62 341 4.0E-23
sp|Q8PWT1|TRUA_METMA tRNA pseudouridine synthase A OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=truA PE=3 SV=1 64 338 4.0E-23
sp|C4KZL4|TRUA_EXISA tRNA pseudouridine synthase A OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=truA PE=3 SV=1 62 340 1.0E-22
sp|A4SWX4|TRUA_POLSQ tRNA pseudouridine synthase A OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=truA PE=3 SV=1 64 356 2.0E-22
sp|Q8TU65|TRUA_METAC tRNA pseudouridine synthase A OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=truA PE=3 SV=1 64 338 2.0E-22
sp|B6YTJ2|TRUA_THEON tRNA pseudouridine synthase A OS=Thermococcus onnurineus (strain NA1) GN=truA PE=3 SV=1 64 380 2.0E-21
sp|B2SGK2|TRUA_FRATM tRNA pseudouridine synthase A OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=truA PE=3 SV=1 66 357 4.0E-21
sp|Q5NG36|TRUA_FRATT tRNA pseudouridine synthase A OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=truA PE=3 SV=1 66 357 1.0E-20
sp|Q14HI8|TRUA_FRAT1 tRNA pseudouridine synthase A OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=truA PE=3 SV=1 66 357 1.0E-20
sp|B1XV49|TRUA_POLNS tRNA pseudouridine synthase A OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=truA PE=3 SV=1 64 356 3.0E-20
sp|Q2NHB4|TRUA_METST tRNA pseudouridine synthase A OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=truA PE=3 SV=1 62 337 7.0E-20
sp|A4IXW8|TRUA_FRATW tRNA pseudouridine synthase A OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=truA PE=3 SV=1 66 357 7.0E-20
sp|A0Q6C2|TRUA_FRATN tRNA pseudouridine synthase A OS=Francisella tularensis subsp. novicida (strain U112) GN=truA PE=3 SV=1 66 357 1.0E-19
sp|Q5JI92|TRUA_THEKO tRNA pseudouridine synthase A OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=truA PE=3 SV=1 64 380 1.0E-19
sp|O58941|TRUA_PYRHO tRNA pseudouridine synthase A OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=truA PE=3 SV=1 64 326 1.0E-19
sp|Q8FS31|TRUA_COREF tRNA pseudouridine synthase A OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=truA PE=3 SV=2 64 360 3.0E-19
sp|Q9Z9J0|TRUA_BACHD tRNA pseudouridine synthase A OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=truA PE=3 SV=1 64 337 3.0E-19
sp|Q0W2P8|TRUA_METAR tRNA pseudouridine synthase A OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=truA PE=3 SV=1 65 381 4.0E-19
sp|A7NCA0|TRUA_FRATF tRNA pseudouridine synthase A OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=truA PE=3 SV=1 66 357 8.0E-19
sp|Q0BLV1|TRUA_FRATO tRNA pseudouridine synthase A OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=truA PE=3 SV=1 66 357 8.0E-19
sp|Q2A3D7|TRUA_FRATH tRNA pseudouridine synthase A OS=Francisella tularensis subsp. holarctica (strain LVS) GN=truA PE=3 SV=1 66 357 8.0E-19
sp|Q46CU8|TRUA_METBF tRNA pseudouridine synthase A OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=truA PE=3 SV=1 64 338 9.0E-19
sp|P60349|TRUA_CORDI tRNA pseudouridine synthase A OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=truA PE=3 SV=1 64 391 1.0E-18
sp|Q12VJ7|TRUA_METBU tRNA pseudouridine synthase A OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=truA PE=3 SV=1 64 344 2.0E-18
sp|A4J151|TRUA_DESRM tRNA pseudouridine synthase A OS=Desulfotomaculum reducens (strain MI-1) GN=truA PE=3 SV=1 64 330 3.0E-18
sp|Q8NVB7|TRUA_STAAW tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain MW2) GN=truA PE=3 SV=1 64 356 3.0E-18
sp|Q6G7A2|TRUA_STAAS tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain MSSA476) GN=truA PE=3 SV=1 64 356 3.0E-18
sp|Q2RFT1|TRUA_MOOTA tRNA pseudouridine synthase A OS=Moorella thermoacetica (strain ATCC 39073) GN=truA PE=3 SV=1 64 337 5.0E-18
sp|Q7NUD6|TRUA_CHRVO tRNA pseudouridine synthase A OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=truA PE=3 SV=1 64 357 5.0E-18
sp|B2U6Z1|TRUA_RALPJ tRNA pseudouridine synthase A OS=Ralstonia pickettii (strain 12J) GN=truA PE=3 SV=1 64 356 5.0E-18
sp|Q9CI80|TRUA_LACLA tRNA pseudouridine synthase A OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=truA PE=3 SV=1 61 338 6.0E-18
sp|Q31HH6|TRUA_THICR tRNA pseudouridine synthase A OS=Thiomicrospira crunogena (strain XCL-2) GN=truA PE=3 SV=1 63 344 7.0E-18
sp|A2SU30|TRUA_METLZ tRNA pseudouridine synthase A OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=truA PE=3 SV=1 66 362 7.0E-18
sp|B8I814|TRUA_CLOCE tRNA pseudouridine synthase A OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=truA PE=3 SV=1 62 336 7.0E-18
sp|C6A238|TRUA_THESM tRNA pseudouridine synthase A OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=truA PE=3 SV=1 64 365 8.0E-18
sp|Q8XXX8|TRUA_RALSO tRNA pseudouridine synthase A OS=Ralstonia solanacearum (strain GMI1000) GN=truA PE=3 SV=1 64 349 8.0E-18
sp|P65849|TRUA_STAAN tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain N315) GN=truA PE=3 SV=1 64 346 9.0E-18
sp|P65848|TRUA_STAAM tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=truA PE=3 SV=1 64 346 9.0E-18
sp|A5IV03|TRUA_STAA9 tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain JH9) GN=truA PE=3 SV=1 64 346 9.0E-18
sp|A6U3U4|TRUA_STAA2 tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain JH1) GN=truA PE=3 SV=1 64 346 9.0E-18
sp|A7X5B5|TRUA_STAA1 tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=truA PE=3 SV=1 64 346 9.0E-18
sp|B1YH83|TRUA_EXIS2 tRNA pseudouridine synthase A OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=truA PE=3 SV=1 68 369 1.0E-17
sp|Q8U2C1|TRUA_PYRFU tRNA pseudouridine synthase A OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=truA PE=3 SV=1 64 376 2.0E-17
sp|A8Z326|TRUA_STAAT tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=truA PE=3 SV=1 64 346 2.0E-17
sp|A6QJ61|TRUA_STAAE tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain Newman) GN=truA PE=3 SV=1 64 346 2.0E-17
sp|Q5HDY9|TRUA_STAAC tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain COL) GN=truA PE=3 SV=1 64 346 2.0E-17
sp|Q2FW37|TRUA_STAA8 tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain NCTC 8325) GN=truA PE=3 SV=1 64 346 2.0E-17
sp|Q2FES0|TRUA_STAA3 tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain USA300) GN=truA PE=3 SV=1 64 346 2.0E-17
sp|A9BGW7|TRUA_PETMO tRNA pseudouridine synthase A OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=truA PE=3 SV=1 62 346 2.0E-17
sp|Q031N1|TRUA_LACLS tRNA pseudouridine synthase A OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=truA PE=3 SV=1 61 337 3.0E-17
sp|Q0AUL4|TRUA_SYNWW tRNA pseudouridine synthase A OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=truA PE=3 SV=1 64 340 3.0E-17
sp|A2RIH1|TRUA_LACLM tRNA pseudouridine synthase A OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=truA PE=3 SV=1 61 337 5.0E-17
sp|Q8Y457|TRUA_LISMO tRNA pseudouridine synthase A OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=truA PE=3 SV=1 61 337 5.0E-17
sp|A5ULI2|TRUA_METS3 tRNA pseudouridine synthase A OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=truA PE=3 SV=1 65 365 5.0E-17
sp|Q6GEL6|TRUA_STAAR tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain MRSA252) GN=truA PE=3 SV=1 64 346 5.0E-17
sp|Q71WI0|TRUA_LISMF tRNA pseudouridine synthase A OS=Listeria monocytogenes serotype 4b (strain F2365) GN=truA PE=3 SV=1 61 337 6.0E-17
sp|C1KZ13|TRUA_LISMC tRNA pseudouridine synthase A OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=truA PE=3 SV=1 61 337 6.0E-17
sp|B2JQE6|TRUA_BURP8 tRNA pseudouridine synthase A OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=truA PE=3 SV=1 64 355 6.0E-17
sp|B0U0B1|TRUA_FRAP2 tRNA pseudouridine synthase A OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=truA PE=3 SV=1 66 357 7.0E-17
sp|Q47XK4|TRUA_COLP3 tRNA pseudouridine synthase A OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=truA PE=3 SV=1 65 337 8.0E-17
sp|A2SHS6|TRUA_METPP tRNA pseudouridine synthase A OS=Methylibium petroleiphilum (strain PM1) GN=truA PE=3 SV=1 64 337 9.0E-17
sp|Q2YYM7|TRUA_STAAB tRNA pseudouridine synthase A OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=truA PE=3 SV=1 64 346 1.0E-16
sp|Q8NSV0|TRUA_CORGL tRNA pseudouridine synthase A OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=truA PE=3 SV=1 64 360 1.0E-16
sp|Q0AGX7|TRUA_NITEC tRNA pseudouridine synthase A OS=Nitrosomonas eutropha (strain C91) GN=truA PE=3 SV=1 64 337 1.0E-16
sp|O87016|TRUA_PSEAE tRNA pseudouridine synthase A OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=truA PE=3 SV=1 64 330 1.0E-16
sp|C0ZIL2|TRUA_BREBN tRNA pseudouridine synthase A OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=truA PE=3 SV=1 68 337 2.0E-16
sp|A0KLN7|TRUA_AERHH tRNA pseudouridine synthase A OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=truA PE=3 SV=1 64 337 2.0E-16
sp|Q13S27|TRUA_BURXL tRNA pseudouridine synthase A OS=Burkholderia xenovorans (strain LB400) GN=truA PE=3 SV=1 64 337 2.0E-16
sp|Q3B3P4|TRUA_CHLL7 tRNA pseudouridine synthase A OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=truA PE=3 SV=1 62 359 2.0E-16
sp|Q49ZD7|TRUA_STAS1 tRNA pseudouridine synthase A OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=truA PE=3 SV=1 64 346 2.0E-16
sp|Q5L3Q7|TRUA_GEOKA tRNA pseudouridine synthase A OS=Geobacillus kaustophilus (strain HTA426) GN=truA PE=3 SV=1 61 337 3.0E-16
sp|B9DM46|TRUA_STACT tRNA pseudouridine synthase A OS=Staphylococcus carnosus (strain TM300) GN=truA PE=3 SV=1 64 346 3.0E-16
sp|B8DB42|TRUA_LISMH tRNA pseudouridine synthase A OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=truA PE=3 SV=1 61 337 3.0E-16
sp|B5XNR9|TRUA_KLEP3 tRNA pseudouridine synthase A OS=Klebsiella pneumoniae (strain 342) GN=truA PE=3 SV=1 64 360 4.0E-16
sp|O28544|TRUA_ARCFU tRNA pseudouridine synthase A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=truA PE=3 SV=1 65 345 5.0E-16
sp|Q87MP1|TRUA_VIBPA tRNA pseudouridine synthase A OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=truA PE=3 SV=1 64 340 5.0E-16
sp|B1KKN8|TRUA_SHEWM tRNA pseudouridine synthase A OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=truA PE=3 SV=1 64 347 5.0E-16
sp|A1VRR5|TRUA_POLNA tRNA pseudouridine synthase A OS=Polaromonas naphthalenivorans (strain CJ2) GN=truA PE=3 SV=1 64 337 6.0E-16
sp|A9BNH5|TRUA_DELAS tRNA pseudouridine synthase A OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=truA PE=3 SV=1 64 348 6.0E-16
sp|Q2T7H3|TRUA_BURTA tRNA pseudouridine synthase A OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=truA PE=3 SV=1 64 338 6.0E-16
sp|Q890R5|TRUA2_CLOTE tRNA pseudouridine synthase A 2 OS=Clostridium tetani (strain Massachusetts / E88) GN=truA2 PE=3 SV=1 62 337 7.0E-16
sp|P60350|TRUA_GEOSL tRNA pseudouridine synthase A OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=truA PE=3 SV=1 62 337 7.0E-16
sp|Q3A3B5|TRUA_PELCD tRNA pseudouridine synthase A OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=truA PE=3 SV=1 63 337 8.0E-16
sp|B2GDT8|TRUA_LACF3 tRNA pseudouridine synthase A OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=truA PE=3 SV=1 66 326 8.0E-16
sp|C6E4S9|TRUA_GEOSM tRNA pseudouridine synthase A OS=Geobacter sp. (strain M21) GN=truA PE=3 SV=1 62 337 9.0E-16
sp|Q15VG2|TRUA_PSEA6 tRNA pseudouridine synthase A OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=truA PE=3 SV=1 64 357 1.0E-15
sp|C1CSL6|TRUA_STRZT tRNA pseudouridine synthase A OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=truA PE=3 SV=1 61 335 1.0E-15
sp|Q2KYM0|TRUA_BORA1 tRNA pseudouridine synthase A OS=Bordetella avium (strain 197N) GN=truA PE=3 SV=1 64 340 1.0E-15
sp|B2T9N4|TRUA_BURPP tRNA pseudouridine synthase A OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=truA PE=3 SV=1 64 337 1.0E-15
sp|Q9UZZ3|TRUA_PYRAB tRNA pseudouridine synthase A OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=truA PE=3 SV=1 64 338 1.0E-15
sp|C5A7E9|TRUA_THEGJ tRNA pseudouridine synthase A OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=truA PE=3 SV=1 64 338 1.0E-15
sp|Q814C2|TRUA1_BACCR tRNA pseudouridine synthase A 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=truA1 PE=3 SV=2 64 340 1.0E-15
sp|B1MVY3|TRUA_LEUCK tRNA pseudouridine synthase A OS=Leuconostoc citreum (strain KM20) GN=truA PE=3 SV=1 61 344 2.0E-15
sp|A8FTU0|TRUA_SHESH tRNA pseudouridine synthase A OS=Shewanella sediminis (strain HAW-EB3) GN=truA PE=3 SV=1 64 347 2.0E-15
sp|Q73F64|TRUA1_BACC1 tRNA pseudouridine synthase A 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=truA1 PE=3 SV=1 64 340 2.0E-15
sp|A3NM70|TRUA_BURP6 tRNA pseudouridine synthase A OS=Burkholderia pseudomallei (strain 668) GN=truA PE=3 SV=1 64 338 3.0E-15
sp|Q3JKH3|TRUA_BURP1 tRNA pseudouridine synthase A OS=Burkholderia pseudomallei (strain 1710b) GN=truA PE=3 SV=1 64 338 3.0E-15
sp|A3P7N2|TRUA_BURP0 tRNA pseudouridine synthase A OS=Burkholderia pseudomallei (strain 1106a) GN=truA PE=3 SV=1 64 338 3.0E-15
sp|A1UZ38|TRUA_BURMS tRNA pseudouridine synthase A OS=Burkholderia mallei (strain SAVP1) GN=truA PE=3 SV=1 64 338 3.0E-15
sp|Q62AJ2|TRUA_BURMA tRNA pseudouridine synthase A OS=Burkholderia mallei (strain ATCC 23344) GN=truA PE=3 SV=1 64 338 3.0E-15
sp|Q63JL6|TRUA_BURPS tRNA pseudouridine synthase A OS=Burkholderia pseudomallei (strain K96243) GN=truA PE=3 SV=1 64 338 3.0E-15
sp|A2S134|TRUA_BURM9 tRNA pseudouridine synthase A OS=Burkholderia mallei (strain NCTC 10229) GN=truA PE=3 SV=1 64 338 3.0E-15
sp|A3MBU2|TRUA_BURM7 tRNA pseudouridine synthase A OS=Burkholderia mallei (strain NCTC 10247) GN=truA PE=3 SV=1 64 338 3.0E-15
sp|A7Z0S0|TRUA_BACMF tRNA pseudouridine synthase A OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=truA PE=3 SV=1 64 340 3.0E-15
sp|A6TC04|TRUA_KLEP7 tRNA pseudouridine synthase A OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=truA PE=3 SV=1 64 360 4.0E-15
sp|B5EFM8|TRUA_GEOBB tRNA pseudouridine synthase A OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=truA PE=3 SV=1 62 338 4.0E-15
sp|B2A4Q5|TRUA_NATTJ tRNA pseudouridine synthase A OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=truA PE=3 SV=1 64 337 4.0E-15
sp|B8GFU5|TRUA_METPE tRNA pseudouridine synthase A OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=truA PE=3 SV=1 64 382 4.0E-15
sp|Q7M7J4|TRUA_VIBVY tRNA pseudouridine synthase A OS=Vibrio vulnificus (strain YJ016) GN=truA PE=3 SV=1 64 340 4.0E-15
sp|Q8CWK3|TRUA_VIBVU tRNA pseudouridine synthase A OS=Vibrio vulnificus (strain CMCP6) GN=truA PE=3 SV=1 64 340 4.0E-15
sp|Q0K8H3|TRUA_CUPNH tRNA pseudouridine synthase A OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=truA PE=3 SV=1 64 357 5.0E-15
sp|Q1WSC1|TRUA_LACS1 tRNA pseudouridine synthase A OS=Lactobacillus salivarius (strain UCC118) GN=truA PE=3 SV=1 61 326 5.0E-15
sp|Q6HPM7|TRUA1_BACHK tRNA pseudouridine synthase A 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=truA1 PE=3 SV=1 64 340 6.0E-15
sp|Q63H59|TRUA1_BACCZ tRNA pseudouridine synthase A 1 OS=Bacillus cereus (strain ZK / E33L) GN=truA1 PE=3 SV=1 64 340 6.0E-15
sp|Q6I4Q2|TRUA1_BACAN tRNA pseudouridine synthase A 1 OS=Bacillus anthracis GN=truA1 PE=3 SV=1 64 340 6.0E-15
sp|A4IJL9|TRUA_GEOTN tRNA pseudouridine synthase A OS=Geobacillus thermodenitrificans (strain NG80-2) GN=truA PE=3 SV=1 61 369 7.0E-15
sp|Q927P1|TRUA_LISIN tRNA pseudouridine synthase A OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=truA PE=3 SV=1 61 337 7.0E-15
sp|Q1H0L9|TRUA_METFK tRNA pseudouridine synthase A OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=truA PE=3 SV=1 64 338 7.0E-15
sp|Q3KLN5|TRUA_CHLTA tRNA pseudouridine synthase A OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=truA PE=3 SV=1 61 346 8.0E-15
sp|B7GJ99|TRUA_ANOFW tRNA pseudouridine synthase A OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=truA PE=3 SV=1 62 326 8.0E-15
sp|B3R117|TRUA_CUPTR tRNA pseudouridine synthase A OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=truA PE=3 SV=1 64 357 8.0E-15
sp|B0BCA1|TRUA_CHLTB tRNA pseudouridine synthase A OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=truA PE=3 SV=1 61 346 8.0E-15
sp|B0B836|TRUA_CHLT2 tRNA pseudouridine synthase A OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=truA PE=3 SV=1 61 346 8.0E-15
sp|A5GB00|TRUA_GEOUR tRNA pseudouridine synthase A OS=Geobacter uraniireducens (strain Rf4) GN=truA PE=3 SV=1 62 337 9.0E-15
sp|A7MS76|TRUA_VIBCB tRNA pseudouridine synthase A OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=truA PE=3 SV=1 64 340 9.0E-15
sp|P70973|TRUA_BACSU tRNA pseudouridine synthase A OS=Bacillus subtilis (strain 168) GN=truA PE=3 SV=2 68 340 9.0E-15
sp|B4RR02|TRUA_NEIG2 tRNA pseudouridine synthase A OS=Neisseria gonorrhoeae (strain NCCP11945) GN=truA PE=3 SV=1 65 357 1.0E-14
sp|C3LTP7|TRUA_VIBCM tRNA pseudouridine synthase A OS=Vibrio cholerae serotype O1 (strain M66-2) GN=truA PE=3 SV=1 64 337 1.0E-14
sp|Q9KTA4|TRUA_VIBCH tRNA pseudouridine synthase A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=truA PE=3 SV=1 64 337 1.0E-14
sp|A5F2T4|TRUA_VIBC3 tRNA pseudouridine synthase A OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=truA PE=3 SV=1 64 337 1.0E-14
sp|A1TLH0|TRUA_ACIAC tRNA pseudouridine synthase A OS=Acidovorax citrulli (strain AAC00-1) GN=truA PE=3 SV=1 64 348 1.0E-14
sp|Q253C0|TRUA_CHLFF tRNA pseudouridine synthase A OS=Chlamydophila felis (strain Fe/C-56) GN=truA PE=3 SV=1 64 337 1.0E-14
sp|O84469|TRUA_CHLTR tRNA pseudouridine synthase A OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=truA PE=3 SV=1 61 346 1.0E-14
sp|Q47HQ7|TRUA_DECAR tRNA pseudouridine synthase A OS=Dechloromonas aromatica (strain RCB) GN=truA PE=3 SV=1 64 340 1.0E-14
sp|C4LF13|TRUA_TOLAT tRNA pseudouridine synthase A OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=truA PE=3 SV=1 64 357 1.0E-14
sp|B3WAI6|TRUA_LACCB tRNA pseudouridine synthase A OS=Lactobacillus casei (strain BL23) GN=truA PE=3 SV=1 66 326 1.0E-14
sp|Q97PL0|TRUA_STRPN tRNA pseudouridine synthase A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=truA PE=3 SV=1 61 335 1.0E-14
sp|C1C8I7|TRUA_STRP7 tRNA pseudouridine synthase A OS=Streptococcus pneumoniae (strain 70585) GN=truA PE=3 SV=1 61 335 1.0E-14
sp|B9MDL6|TRUA_ACIET tRNA pseudouridine synthase A OS=Acidovorax ebreus (strain TPSY) GN=truA PE=3 SV=1 64 348 2.0E-14
sp|Q9RS37|TRUA_DEIRA tRNA pseudouridine synthase A OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=truA PE=3 SV=1 66 344 2.0E-14
sp|Q9JWF1|TRUA_NEIMA tRNA pseudouridine synthase A OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=truA PE=3 SV=1 65 357 2.0E-14
sp|A4WCV2|TRUA_ENT38 tRNA pseudouridine synthase A OS=Enterobacter sp. (strain 638) GN=truA PE=3 SV=1 64 360 2.0E-14
sp|Q9PJT0|TRUA_CHLMU tRNA pseudouridine synthase A OS=Chlamydia muridarum (strain MoPn / Nigg) GN=truA PE=3 SV=1 61 346 2.0E-14
sp|Q035B5|TRUA_LACC3 tRNA pseudouridine synthase A OS=Lactobacillus casei (strain ATCC 334) GN=truA PE=3 SV=1 66 326 2.0E-14
sp|Q8CXP1|TRUA_OCEIH tRNA pseudouridine synthase A OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=truA PE=3 SV=1 68 359 2.0E-14
sp|Q8DWH1|TRUA_STRMU tRNA pseudouridine synthase A OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=truA PE=3 SV=1 68 326 2.0E-14
sp|Q7U376|TRUA_BORPA tRNA pseudouridine synthase A OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=truA PE=3 SV=1 64 356 3.0E-14
sp|Q7U386|TRUA_BORBR tRNA pseudouridine synthase A OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=truA PE=3 SV=1 64 356 3.0E-14
sp|Q604P1|TRUA_METCA tRNA pseudouridine synthase A OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=truA PE=3 SV=1 64 344 3.0E-14
sp|A6T009|TRUA_JANMA tRNA pseudouridine synthase A OS=Janthinobacterium sp. (strain Marseille) GN=truA PE=3 SV=1 64 338 3.0E-14
sp|Q6MDE3|TRUA2_PARUW tRNA pseudouridine synthase A 2 OS=Protochlamydia amoebophila (strain UWE25) GN=truA2 PE=3 SV=1 47 326 3.0E-14
sp|A4JMC2|TRUA_BURVG tRNA pseudouridine synthase A OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=truA PE=3 SV=1 64 356 4.0E-14
sp|B9LJG1|TRUA_CHLSY tRNA pseudouridine synthase A OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=truA PE=3 SV=1 62 326 4.0E-14
sp|A9WH95|TRUA_CHLAA tRNA pseudouridine synthase A OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=truA PE=3 SV=1 62 326 4.0E-14
sp|A1WAT5|TRUA_ACISJ tRNA pseudouridine synthase A OS=Acidovorax sp. (strain JS42) GN=truA PE=3 SV=1 64 348 4.0E-14
sp|C1CLU3|TRUA_STRZP tRNA pseudouridine synthase A OS=Streptococcus pneumoniae (strain P1031) GN=truA PE=3 SV=1 61 335 5.0E-14
sp|Q5L6V3|TRUA_CHLAB tRNA pseudouridine synthase A OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=truA PE=3 SV=1 64 346 5.0E-14
sp|Q3IF40|TRUA_PSEHT tRNA pseudouridine synthase A OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=truA PE=3 SV=1 64 341 5.0E-14
sp|A3CXX4|TRUA_METMJ tRNA pseudouridine synthase A OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=truA PE=3 SV=1 64 360 5.0E-14
sp|Q8XHV5|TRUA2_CLOPE tRNA pseudouridine synthase A 2 OS=Clostridium perfringens (strain 13 / Type A) GN=truA2 PE=3 SV=1 62 338 5.0E-14
sp|B5E6N8|TRUA_STRP4 tRNA pseudouridine synthase A OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=truA PE=3 SV=1 61 335 6.0E-14
sp|Q8XLQ0|TRUA1_CLOPE tRNA pseudouridine synthase A 1 OS=Clostridium perfringens (strain 13 / Type A) GN=truA1 PE=3 SV=1 62 344 6.0E-14
sp|Q5WLN0|TRUA_BACSK tRNA pseudouridine synthase A OS=Bacillus clausii (strain KSM-K16) GN=truA PE=3 SV=1 64 326 6.0E-14
sp|C5CGS8|TRUA_KOSOT tRNA pseudouridine synthase A OS=Kosmotoga olearia (strain TBF 19.5.1) GN=truA PE=3 SV=1 62 363 7.0E-14
sp|B8CPW5|TRUA_SHEPW tRNA pseudouridine synthase A OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=truA PE=3 SV=1 64 357 7.0E-14
sp|C1CFH9|TRUA_STRZJ tRNA pseudouridine synthase A OS=Streptococcus pneumoniae (strain JJA) GN=truA PE=3 SV=1 61 335 8.0E-14
sp|Q8CWQ1|TRUA_STRR6 tRNA pseudouridine synthase A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=truA PE=3 SV=1 61 335 8.0E-14
sp|B2IRB1|TRUA_STRPS tRNA pseudouridine synthase A OS=Streptococcus pneumoniae (strain CGSP14) GN=truA PE=3 SV=1 61 335 8.0E-14
sp|B8ZM12|TRUA_STRPJ tRNA pseudouridine synthase A OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=truA PE=3 SV=1 61 335 8.0E-14
sp|B1ID11|TRUA_STRPI tRNA pseudouridine synthase A OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=truA PE=3 SV=1 61 335 8.0E-14
sp|Q04JF7|TRUA_STRP2 tRNA pseudouridine synthase A OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=truA PE=3 SV=1 61 335 8.0E-14
sp|A9IRL0|TRUA_BORPD tRNA pseudouridine synthase A OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=truA PE=3 SV=1 64 326 8.0E-14
sp|Q5FM60|TRUA_LACAC tRNA pseudouridine synthase A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=truA PE=3 SV=1 61 324 9.0E-14
sp|P9WHP9|TRUA_MYCTU tRNA pseudouridine synthase A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=truA PE=1 SV=1 66 360 9.0E-14
sp|P9WHP8|TRUA_MYCTO tRNA pseudouridine synthase A OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=truA PE=3 SV=1 66 360 9.0E-14
sp|P65847|TRUA_MYCBO tRNA pseudouridine synthase A OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=truA PE=3 SV=1 66 360 9.0E-14
sp|A4SNT8|TRUA_AERS4 tRNA pseudouridine synthase A OS=Aeromonas salmonicida (strain A449) GN=truA PE=3 SV=1 64 357 9.0E-14
sp|Q4L882|TRUA_STAHJ tRNA pseudouridine synthase A OS=Staphylococcus haemolyticus (strain JCSC1435) GN=truA PE=3 SV=1 64 338 1.0E-13
sp|B9MKC1|TRUA_CALBD tRNA pseudouridine synthase A OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=truA PE=3 SV=1 62 263 1.0E-13
sp|B1I1B5|TRUA_DESAP tRNA pseudouridine synthase A OS=Desulforudis audaxviator (strain MP104C) GN=truA PE=3 SV=1 64 324 1.0E-13
sp|A8ADR1|TRUA_CITK8 tRNA pseudouridine synthase A OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=truA PE=3 SV=1 64 360 1.0E-13
sp|A4SE87|TRUA_CHLPM tRNA pseudouridine synthase A OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=truA PE=3 SV=1 64 330 1.0E-13
sp|O66953|TRUA_AQUAE tRNA pseudouridine synthase A OS=Aquifex aeolicus (strain VF5) GN=truA PE=3 SV=1 66 337 1.0E-13
sp|Q9Z7X4|TRUA_CHLPN tRNA pseudouridine synthase A OS=Chlamydia pneumoniae GN=truA PE=3 SV=2 64 356 1.0E-13
sp|Q5QUE5|TRUA_IDILO tRNA pseudouridine synthase A OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=truA PE=3 SV=1 64 337 1.0E-13
sp|A8YTB0|TRUA_LACH4 tRNA pseudouridine synthase A OS=Lactobacillus helveticus (strain DPC 4571) GN=truA PE=3 SV=1 60 326 1.0E-13
sp|Q88XU9|TRUA_LACPL tRNA pseudouridine synthase A OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=truA PE=3 SV=1 60 344 2.0E-13
sp|A7HKV8|TRUA_FERNB tRNA pseudouridine synthase A OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=truA PE=3 SV=1 62 337 2.0E-13
sp|B7LLF2|TRUA_ESCF3 tRNA pseudouridine synthase A OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=truA PE=3 SV=1 64 360 2.0E-13
sp|B7VL84|TRUA_VIBTL tRNA pseudouridine synthase A OS=Vibrio tasmaniensis (strain LGP32) GN=truA PE=3 SV=1 64 340 2.0E-13
sp|Q32DL8|TRUA_SHIDS tRNA pseudouridine synthase A OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=truA PE=3 SV=1 64 360 2.0E-13
sp|B1LLS3|TRUA_ECOSM tRNA pseudouridine synthase A OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=truA PE=3 SV=1 64 360 2.0E-13
sp|B7N5T0|TRUA_ECOLU tRNA pseudouridine synthase A OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=truA PE=3 SV=1 64 360 2.0E-13
sp|P65844|TRUA_ECOL6 tRNA pseudouridine synthase A OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=truA PE=3 SV=1 64 360 2.0E-13
sp|B7NNZ9|TRUA_ECO7I tRNA pseudouridine synthase A OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=truA PE=3 SV=1 64 360 2.0E-13
sp|B5YXV8|TRUA_ECO5E tRNA pseudouridine synthase A OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=truA PE=3 SV=1 64 360 2.0E-13
sp|P65845|TRUA_ECO57 tRNA pseudouridine synthase A OS=Escherichia coli O157:H7 GN=truA PE=3 SV=1 64 360 2.0E-13
sp|B7LBH2|TRUA_ECO55 tRNA pseudouridine synthase A OS=Escherichia coli (strain 55989 / EAEC) GN=truA PE=3 SV=1 64 360 2.0E-13
sp|Q83QR3|TRUA_SHIFL tRNA pseudouridine synthase A OS=Shigella flexneri GN=truA PE=3 SV=1 64 360 2.0E-13
sp|Q0T2G7|TRUA_SHIF8 tRNA pseudouridine synthase A OS=Shigella flexneri serotype 5b (strain 8401) GN=truA PE=3 SV=1 64 360 2.0E-13
sp|B2TWA0|TRUA_SHIB3 tRNA pseudouridine synthase A OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=truA PE=3 SV=1 64 360 2.0E-13
sp|B6I4U6|TRUA_ECOSE tRNA pseudouridine synthase A OS=Escherichia coli (strain SE11) GN=truA PE=3 SV=1 64 360 2.0E-13
sp|B7M6J9|TRUA_ECO8A tRNA pseudouridine synthase A OS=Escherichia coli O8 (strain IAI1) GN=truA PE=3 SV=1 64 360 2.0E-13
sp|P59508|TRUA_BUCBP tRNA pseudouridine synthase A OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=truA PE=3 SV=1 64 357 3.0E-13
sp|Q1R994|TRUA_ECOUT tRNA pseudouridine synthase A OS=Escherichia coli (strain UTI89 / UPEC) GN=truA PE=3 SV=1 64 360 3.0E-13
sp|Q0TFC8|TRUA_ECOL5 tRNA pseudouridine synthase A OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=truA PE=3 SV=1 64 360 3.0E-13
sp|A1ADG7|TRUA_ECOK1 tRNA pseudouridine synthase A OS=Escherichia coli O1:K1 / APEC GN=truA PE=3 SV=1 64 360 3.0E-13
sp|B7MXZ5|TRUA_ECO81 tRNA pseudouridine synthase A OS=Escherichia coli O81 (strain ED1a) GN=truA PE=3 SV=1 64 360 3.0E-13
sp|B7MG82|TRUA_ECO45 tRNA pseudouridine synthase A OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=truA PE=3 SV=1 64 360 3.0E-13
sp|B7UFX6|TRUA_ECO27 tRNA pseudouridine synthase A OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=truA PE=3 SV=1 64 360 3.0E-13
sp|A7ZPD3|TRUA_ECO24 tRNA pseudouridine synthase A OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=truA PE=3 SV=1 64 360 3.0E-13
sp|Q31YE0|TRUA_SHIBS tRNA pseudouridine synthase A OS=Shigella boydii serotype 4 (strain Sb227) GN=truA PE=3 SV=1 64 360 3.0E-13
sp|A5USG0|TRUA_ROSS1 tRNA pseudouridine synthase A OS=Roseiflexus sp. (strain RS-1) GN=truA PE=3 SV=1 62 326 4.0E-13
sp|A3DJK8|TRUA_CLOTH tRNA pseudouridine synthase A OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=truA PE=3 SV=1 62 357 4.0E-13
sp|Q9Y606|TRUA_HUMAN tRNA pseudouridine synthase A, mitochondrial OS=Homo sapiens GN=PUS1 PE=1 SV=3 29 341 4.0E-13
sp|Q5Z1K7|TRUA_NOCFA tRNA pseudouridine synthase A OS=Nocardia farcinica (strain IFM 10152) GN=truA PE=3 SV=1 122 360 5.0E-13
sp|P07649|TRUA_ECOLI tRNA pseudouridine synthase A OS=Escherichia coli (strain K12) GN=truA PE=1 SV=1 64 360 5.0E-13
sp|B1X929|TRUA_ECODH tRNA pseudouridine synthase A OS=Escherichia coli (strain K12 / DH10B) GN=truA PE=3 SV=1 64 360 5.0E-13
sp|C4ZVL1|TRUA_ECOBW tRNA pseudouridine synthase A OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=truA PE=3 SV=1 64 360 5.0E-13
sp|Q65TC8|TRUA_MANSM tRNA pseudouridine synthase A OS=Mannheimia succiniciproducens (strain MBEL55E) GN=truA PE=3 SV=2 64 337 5.0E-13
sp|B0USP1|TRUA_HISS2 tRNA pseudouridine synthase A OS=Histophilus somni (strain 2336) GN=truA PE=3 SV=1 64 341 5.0E-13
sp|B3E0A0|TRUA_METI4 tRNA pseudouridine synthase A OS=Methylacidiphilum infernorum (isolate V4) GN=truA PE=3 SV=1 66 326 6.0E-13
sp|C5CSH0|TRUA_VARPS tRNA pseudouridine synthase A OS=Variovorax paradoxus (strain S110) GN=truA PE=3 SV=1 64 341 6.0E-13
sp|P57861|TRUA_PASMU tRNA pseudouridine synthase A OS=Pasteurella multocida (strain Pm70) GN=truA PE=3 SV=1 64 337 6.0E-13
sp|B2S1K1|TRUA_BORHD tRNA pseudouridine synthase A OS=Borrelia hermsii (strain HS1 / DAH) GN=truA PE=3 SV=1 64 338 6.0E-13
sp|A9M0B8|TRUA_NEIM0 tRNA pseudouridine synthase A OS=Neisseria meningitidis serogroup C (strain 053442) GN=truA PE=3 SV=1 65 357 6.0E-13
sp|B1IXM4|TRUA_ECOLC tRNA pseudouridine synthase A OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=truA PE=3 SV=1 64 360 7.0E-13
sp|A8A2I7|TRUA_ECOHS tRNA pseudouridine synthase A OS=Escherichia coli O9:H4 (strain HS) GN=truA PE=3 SV=1 64 360 7.0E-13
sp|Q126M3|TRUA_POLSJ tRNA pseudouridine synthase A OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=truA PE=3 SV=1 64 348 7.0E-13
sp|B6EIW6|TRUA_ALISL tRNA pseudouridine synthase A OS=Aliivibrio salmonicida (strain LFI1238) GN=truA PE=3 SV=1 64 340 7.0E-13
sp|Q0I4X5|TRUA_HAES1 tRNA pseudouridine synthase A OS=Haemophilus somnus (strain 129Pt) GN=truA PE=3 SV=1 64 341 8.0E-13
sp|A7MH65|TRUA_CROS8 tRNA pseudouridine synthase A OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=truA PE=3 SV=1 64 360 8.0E-13
sp|Q8ZNB9|TRUA_SALTY tRNA pseudouridine synthase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=truA PE=3 SV=1 64 360 9.0E-13
sp|C4XPZ9|TRUA_DESMR tRNA pseudouridine synthase A OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=truA PE=3 SV=1 66 356 9.0E-13
sp|Q5HM30|TRUA_STAEQ tRNA pseudouridine synthase A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=truA PE=3 SV=1 123 337 9.0E-13
sp|Q8R7Y7|TRUA_CALS4 tRNA pseudouridine synthase A OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=truA PE=3 SV=1 66 326 1.0E-12
sp|Q8Z500|TRUA_SALTI tRNA pseudouridine synthase A OS=Salmonella typhi GN=truA PE=3 SV=1 64 360 1.0E-12
sp|B4TQA4|TRUA_SALSV tRNA pseudouridine synthase A OS=Salmonella schwarzengrund (strain CVM19633) GN=truA PE=3 SV=1 64 360 1.0E-12
sp|B5BCH8|TRUA_SALPK tRNA pseudouridine synthase A OS=Salmonella paratyphi A (strain AKU_12601) GN=truA PE=3 SV=1 64 360 1.0E-12
sp|C0PZZ5|TRUA_SALPC tRNA pseudouridine synthase A OS=Salmonella paratyphi C (strain RKS4594) GN=truA PE=3 SV=1 64 360 1.0E-12
sp|A9N476|TRUA_SALPB tRNA pseudouridine synthase A OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=truA PE=3 SV=1 64 360 1.0E-12
sp|Q5PCV6|TRUA_SALPA tRNA pseudouridine synthase A OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=truA PE=3 SV=1 64 360 1.0E-12
sp|B4SZP0|TRUA_SALNS tRNA pseudouridine synthase A OS=Salmonella newport (strain SL254) GN=truA PE=3 SV=1 64 360 1.0E-12
sp|B4TBN7|TRUA_SALHS tRNA pseudouridine synthase A OS=Salmonella heidelberg (strain SL476) GN=truA PE=3 SV=1 64 360 1.0E-12
sp|B5RCJ3|TRUA_SALG2 tRNA pseudouridine synthase A OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=truA PE=3 SV=1 64 360 1.0E-12
sp|B5R349|TRUA_SALEP tRNA pseudouridine synthase A OS=Salmonella enteritidis PT4 (strain P125109) GN=truA PE=3 SV=1 64 360 1.0E-12
sp|B5FPL2|TRUA_SALDC tRNA pseudouridine synthase A OS=Salmonella dublin (strain CT_02021853) GN=truA PE=3 SV=1 64 360 1.0E-12
sp|Q57LY6|TRUA_SALCH tRNA pseudouridine synthase A OS=Salmonella choleraesuis (strain SC-B67) GN=truA PE=3 SV=1 64 360 1.0E-12
sp|B5EZQ2|TRUA_SALA4 tRNA pseudouridine synthase A OS=Salmonella agona (strain SL483) GN=truA PE=3 SV=1 64 360 1.0E-12
sp|B8G6P6|TRUA_CHLAD tRNA pseudouridine synthase A OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=truA PE=3 SV=1 62 326 1.0E-12
sp|Q6LNU5|TRUA_PHOPR tRNA pseudouridine synthase A OS=Photobacterium profundum GN=truA PE=3 SV=1 64 337 1.0E-12
sp|B2G8U7|TRUA_LACRJ tRNA pseudouridine synthase A OS=Lactobacillus reuteri (strain JCM 1112) GN=truA PE=3 SV=1 66 337 1.0E-12
sp|A5VLH4|TRUA_LACRD tRNA pseudouridine synthase A OS=Lactobacillus reuteri (strain DSM 20016) GN=truA PE=3 SV=1 66 337 1.0E-12
sp|Q73S41|TRUA_MYCPA tRNA pseudouridine synthase A OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=truA PE=3 SV=1 121 357 1.0E-12
sp|Q8CML6|TRUA_STAES tRNA pseudouridine synthase A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=truA PE=3 SV=1 123 337 1.0E-12
sp|Q3YZP3|TRUA_SHISS tRNA pseudouridine synthase A OS=Shigella sonnei (strain Ss046) GN=truA PE=3 SV=1 64 360 1.0E-12
sp|C6BW69|TRUA_DESAD tRNA pseudouridine synthase A OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=truA PE=3 SV=1 64 340 1.0E-12
sp|A9ND24|TRUA_COXBR tRNA pseudouridine synthase A OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=truA PE=3 SV=1 64 357 1.0E-12
sp|A9KFZ5|TRUA_COXBN tRNA pseudouridine synthase A OS=Coxiella burnetii (strain Dugway 5J108-111) GN=truA PE=3 SV=1 64 357 1.0E-12
sp|B6J0H0|TRUA_COXB2 tRNA pseudouridine synthase A OS=Coxiella burnetii (strain CbuG_Q212) GN=truA PE=3 SV=1 64 357 1.0E-12
sp|B6J6W3|TRUA_COXB1 tRNA pseudouridine synthase A OS=Coxiella burnetii (strain CbuK_Q154) GN=truA PE=3 SV=1 64 357 1.0E-12
sp|A6LLJ7|TRUA_THEM4 tRNA pseudouridine synthase A OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=truA PE=3 SV=1 65 337 1.0E-12
sp|Q8TWZ3|TRUA_METKA tRNA pseudouridine synthase A OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=truA PE=3 SV=1 64 359 1.0E-12
sp|A4G4G0|TRUA_HERAR tRNA pseudouridine synthase A OS=Herminiimonas arsenicoxydans GN=truA PE=3 SV=1 60 356 2.0E-12
sp|B3EIU9|TRUA_CHLL2 tRNA pseudouridine synthase A OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=truA PE=3 SV=1 64 338 2.0E-12
sp|A4XKB7|TRUA_CALS8 tRNA pseudouridine synthase A OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=truA PE=3 SV=1 62 283 2.0E-12
sp|Q4KM92|TRUA_RAT tRNA pseudouridine synthase A, mitochondrial OS=Rattus norvegicus GN=Pus1 PE=1 SV=2 25 333 2.0E-12
sp|Q5SHU9|TRUA_THET8 tRNA pseudouridine synthase A OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=truA PE=1 SV=1 62 339 2.0E-12
sp|Q72I65|TRUA_THET2 tRNA pseudouridine synthase A OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=truA PE=3 SV=1 62 339 2.0E-12
sp|A0ALT4|TRUA_LISW6 tRNA pseudouridine synthase A OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=truA PE=3 SV=1 61 337 2.0E-12
sp|Q9WU56|TRUA_MOUSE tRNA pseudouridine synthase A, mitochondrial OS=Mus musculus GN=Pus1 PE=1 SV=2 25 333 2.0E-12
sp|Q82DM1|TRUA_STRAW tRNA pseudouridine synthase A OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=truA PE=3 SV=1 64 339 2.0E-12
sp|Q8R601|TRUA_FUSNN tRNA pseudouridine synthase A OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=truA PE=3 SV=1 64 300 2.0E-12
sp|Q4QL79|TRUA_HAEI8 tRNA pseudouridine synthase A OS=Haemophilus influenzae (strain 86-028NP) GN=truA PE=3 SV=1 64 344 3.0E-12
sp|B1HMV0|TRUA_LYSSC tRNA pseudouridine synthase A OS=Lysinibacillus sphaericus (strain C3-41) GN=truA PE=3 SV=1 62 333 3.0E-12
sp|B6IPI0|TRUA_RHOCS tRNA pseudouridine synthase A OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=truA PE=3 SV=1 66 326 4.0E-12
sp|Q38UV3|TRUA_LACSS tRNA pseudouridine synthase A OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=truA PE=3 SV=1 66 326 4.0E-12
sp|A5UIY2|TRUA_HAEIG tRNA pseudouridine synthase A OS=Haemophilus influenzae (strain PittGG) GN=truA PE=3 SV=1 64 344 5.0E-12
sp|A1WSF3|TRUA_VEREI tRNA pseudouridine synthase A OS=Verminephrobacter eiseniae (strain EF01-2) GN=truA PE=3 SV=1 64 337 5.0E-12
sp|Q0VPI7|TRUA_ALCBS tRNA pseudouridine synthase A OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=truA PE=3 SV=1 64 337 5.0E-12
sp|B9M6W5|TRUA_GEODF tRNA pseudouridine synthase A OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=truA PE=3 SV=1 62 337 5.0E-12
sp|B8E1G5|TRUA_DICTD tRNA pseudouridine synthase A OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=truA PE=3 SV=1 66 252 5.0E-12
sp|Q5LGZ6|TRUA_BACFN tRNA pseudouridine synthase A OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=truA PE=3 SV=1 66 326 5.0E-12
sp|Q46YW3|TRUA_CUPPJ tRNA pseudouridine synthase A OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=truA PE=3 SV=1 64 356 6.0E-12
sp|Q64XV0|TRUA_BACFR tRNA pseudouridine synthase A OS=Bacteroides fragilis (strain YCH46) GN=truA PE=3 SV=1 66 326 6.0E-12
sp|P57295|TRUA_BUCAI tRNA pseudouridine synthase A OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=truA PE=3 SV=1 60 337 7.0E-12
sp|P45291|TRUA_HAEIN tRNA pseudouridine synthase A OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=truA PE=3 SV=1 64 344 7.0E-12
sp|B7IHS2|TRUA_THEAB tRNA pseudouridine synthase A OS=Thermosipho africanus (strain TCF52B) GN=truA PE=3 SV=1 65 337 7.0E-12
sp|Q2JFE6|TRUA_FRASC tRNA pseudouridine synthase A OS=Frankia sp. (strain CcI3) GN=truA PE=3 SV=1 66 366 8.0E-12
sp|Q97EL1|TRUA_CLOAB tRNA pseudouridine synthase A OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=truA PE=3 SV=1 64 337 9.0E-12
sp|Q663A0|TRUA_BORBP tRNA pseudouridine synthase A OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=truA PE=3 SV=1 64 337 1.0E-11
sp|C5D3U9|TRUA_GEOSW tRNA pseudouridine synthase A OS=Geobacillus sp. (strain WCH70) GN=truA PE=3 SV=1 64 326 1.0E-11
sp|B8D7A3|TRUA_BUCAT tRNA pseudouridine synthase A OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=truA PE=3 SV=1 60 337 1.0E-11
sp|B8D8Z8|TRUA_BUCA5 tRNA pseudouridine synthase A OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=truA PE=3 SV=1 60 337 1.0E-11
sp|Q83WJ5|TRUA_BURM1 tRNA pseudouridine synthase A OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=truA PE=3 SV=1 64 356 1.0E-11
sp|B5YDX5|TRUA_DICT6 tRNA pseudouridine synthase A OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=truA PE=3 SV=1 66 248 2.0E-11
sp|A1AUF4|TRUA_PELPD tRNA pseudouridine synthase A OS=Pelobacter propionicus (strain DSM 2379) GN=truA PE=3 SV=1 62 363 2.0E-11
sp|A8AVB3|TRUA_STRGC tRNA pseudouridine synthase A OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=truA PE=3 SV=1 61 325 2.0E-11
sp|Q820P8|TRUA_NITEU tRNA pseudouridine synthase A OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=truA PE=3 SV=1 64 337 2.0E-11
sp|Q2WAT0|TRUA_MAGSA tRNA pseudouridine synthase A OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=truA PE=3 SV=1 66 340 3.0E-11
sp|A8F526|TRUA_PSELT tRNA pseudouridine synthase A OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=truA PE=3 SV=1 62 344 3.0E-11
sp|A1BFF0|TRUA_CHLPD tRNA pseudouridine synthase A OS=Chlorobium phaeobacteroides (strain DSM 266) GN=truA PE=3 SV=1 64 368 3.0E-11
sp|A7NR34|TRUA_ROSCS tRNA pseudouridine synthase A OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=truA PE=3 SV=1 62 326 3.0E-11
sp|Q74L59|TRUA_LACJO tRNA pseudouridine synthase A OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=truA PE=3 SV=1 60 325 3.0E-11
sp|A9MJ57|TRUA_SALAR tRNA pseudouridine synthase A OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=truA PE=3 SV=1 64 360 3.0E-11
sp|A2BTB3|TRUA_PROMS tRNA pseudouridine synthase A OS=Prochlorococcus marinus (strain AS9601) GN=truA PE=3 SV=1 64 335 4.0E-11
sp|Q6MEE7|TRUA1_PARUW tRNA pseudouridine synthase A 1 OS=Protochlamydia amoebophila (strain UWE25) GN=truA1 PE=3 SV=1 66 245 5.0E-11
sp|A5FVK4|TRUA_ACICJ tRNA pseudouridine synthase A OS=Acidiphilium cryptum (strain JF-5) GN=truA PE=3 SV=1 65 357 5.0E-11
sp|Q2NIY3|TRUA_AYWBP tRNA pseudouridine synthase A OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=truA PE=3 SV=1 63 329 6.0E-11
sp|B8F382|TRUA_HAEPS tRNA pseudouridine synthase A OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=truA PE=3 SV=1 64 326 6.0E-11
sp|Q12P55|TRUA_SHEDO tRNA pseudouridine synthase A OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=truA PE=3 SV=1 64 347 6.0E-11
sp|Q8KDR7|TRUA_CHLTE tRNA pseudouridine synthase A OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=truA PE=3 SV=1 60 363 7.0E-11
sp|A1QYG5|TRUA_BORT9 tRNA pseudouridine synthase A OS=Borrelia turicatae (strain 91E135) GN=truA PE=3 SV=1 67 338 7.0E-11
sp|B5RQJ5|TRUA_BORRA tRNA pseudouridine synthase A OS=Borrelia recurrentis (strain A1) GN=truA PE=3 SV=1 64 321 8.0E-11
sp|B5RLM0|TRUA_BORDL tRNA pseudouridine synthase A OS=Borrelia duttonii (strain Ly) GN=truA PE=3 SV=1 64 321 8.0E-11
sp|B0BPI7|TRUA_ACTPJ tRNA pseudouridine synthase A OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=truA PE=3 SV=1 64 337 8.0E-11
sp|Q03ZL3|TRUA_LEUMM tRNA pseudouridine synthase A OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=truA PE=3 SV=1 68 344 1.0E-10
sp|Q01WL4|TRUA_SOLUE tRNA pseudouridine synthase A OS=Solibacter usitatus (strain Ellin6076) GN=truA PE=3 SV=1 62 326 1.0E-10
sp|P0DD47|TRUA_STRPQ tRNA pseudouridine synthase A OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=truA PE=3 SV=1 68 333 1.0E-10
sp|P0DD46|TRUA_STRP3 tRNA pseudouridine synthase A OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=truA PE=3 SV=1 68 333 1.0E-10
sp|Q04BY4|TRUA_LACDB tRNA pseudouridine synthase A OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=truA PE=3 SV=1 66 344 1.0E-10
sp|O86776|TRUA_STRCO tRNA pseudouridine synthase A OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=truA PE=3 SV=1 64 337 1.0E-10
sp|B0K5S6|TRUA_THEPX tRNA pseudouridine synthase A OS=Thermoanaerobacter sp. (strain X514) GN=truA PE=3 SV=1 62 337 1.0E-10
sp|B0KCN3|TRUA_THEP3 tRNA pseudouridine synthase A OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=truA PE=3 SV=1 62 337 1.0E-10
sp|Q5UXW0|TRUA_HALMA tRNA pseudouridine synthase A OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=truA PE=3 SV=1 65 378 1.0E-10
sp|Q2RNZ9|TRUA_RHORT tRNA pseudouridine synthase A OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=truA PE=3 SV=1 66 326 1.0E-10
sp|A1SW72|TRUA_PSYIN tRNA pseudouridine synthase A OS=Psychromonas ingrahamii (strain 37) GN=truA PE=3 SV=1 64 259 1.0E-10
sp|Q03MR4|TRUA_STRTD tRNA pseudouridine synthase A OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=truA PE=3 SV=1 68 326 1.0E-10
sp|Q5M6C9|TRUA_STRT2 tRNA pseudouridine synthase A OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=truA PE=3 SV=1 68 337 1.0E-10
sp|Q5M1T6|TRUA_STRT1 tRNA pseudouridine synthase A OS=Streptococcus thermophilus (strain CNRZ 1066) GN=truA PE=3 SV=1 68 337 1.0E-10
sp|B3GXP8|TRUA_ACTP7 tRNA pseudouridine synthase A OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=truA PE=3 SV=1 64 337 2.0E-10
sp|Q5ZVY6|TRUA_LEGPH tRNA pseudouridine synthase A OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=truA PE=3 SV=1 64 340 2.0E-10
sp|A5IBF5|TRUA_LEGPC tRNA pseudouridine synthase A OS=Legionella pneumophila (strain Corby) GN=truA PE=3 SV=1 64 340 2.0E-10
sp|Q5X5Q4|TRUA_LEGPA tRNA pseudouridine synthase A OS=Legionella pneumophila (strain Paris) GN=truA PE=3 SV=1 64 340 2.0E-10
sp|Q5WX34|TRUA_LEGPL tRNA pseudouridine synthase A OS=Legionella pneumophila (strain Lens) GN=truA PE=3 SV=1 64 340 2.0E-10
sp|Q3IMP6|TRUA_NATPD tRNA pseudouridine synthase A OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=truA PE=3 SV=1 65 254 2.0E-10
sp|B1W3X8|TRUA_STRGG tRNA pseudouridine synthase A OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=truA PE=3 SV=1 64 340 2.0E-10
sp|Q3AQT7|TRUA_CHLCH tRNA pseudouridine synthase A OS=Chlorobium chlorochromatii (strain CaD3) GN=truA PE=3 SV=1 62 252 2.0E-10
sp|Q318K9|TRUA_PROM9 tRNA pseudouridine synthase A OS=Prochlorococcus marinus (strain MIT 9312) GN=truA PE=3 SV=1 64 341 2.0E-10
sp|Q168C1|TRUA_ROSDO tRNA pseudouridine synthase A OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=truA PE=3 SV=1 65 343 2.0E-10
sp|Q2GF33|TRUA_NEOSM tRNA pseudouridine synthase A OS=Neorickettsia sennetsu (strain Miyayama) GN=truA PE=3 SV=1 70 326 3.0E-10
sp|A3QFC4|TRUA_SHELP tRNA pseudouridine synthase A OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=truA PE=3 SV=1 64 347 3.0E-10
sp|Q28LN3|TRUA_JANSC tRNA pseudouridine synthase A OS=Jannaschia sp. (strain CCS1) GN=truA PE=3 SV=1 65 330 3.0E-10
sp|Q6FEV2|TRUA_ACIAD tRNA pseudouridine synthase A OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=truA PE=3 SV=1 65 340 3.0E-10
sp|Q2NCT7|TRUA_ERYLH tRNA pseudouridine synthase A OS=Erythrobacter litoralis (strain HTCC2594) GN=truA PE=3 SV=1 61 326 3.0E-10
sp|Q21XI4|TRUA_RHOFT tRNA pseudouridine synthase A OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=truA PE=3 SV=1 64 337 4.0E-10
sp|A2ADA5|PUSL1_MOUSE tRNA pseudouridine synthase-like 1 OS=Mus musculus GN=Pusl1 PE=1 SV=1 109 340 4.0E-10
sp|Q7U363|TRUA_BORPE tRNA pseudouridine synthase A OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=truA PE=3 SV=1 64 356 5.0E-10
sp|A0KV94|TRUA_SHESA tRNA pseudouridine synthase A OS=Shewanella sp. (strain ANA-3) GN=truA PE=3 SV=1 64 347 5.0E-10
sp|Q0HWL5|TRUA_SHESR tRNA pseudouridine synthase A OS=Shewanella sp. (strain MR-7) GN=truA PE=3 SV=1 64 347 6.0E-10
sp|Q89ZY4|TRUA_BACTN tRNA pseudouridine synthase A OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=truA PE=3 SV=1 66 326 7.0E-10
sp|A6LDA7|TRUA_PARD8 tRNA pseudouridine synthase A OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=truA PE=3 SV=1 66 326 8.0E-10
sp|Q7U335|TRUA_HAEDU tRNA pseudouridine synthase A OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=truA PE=3 SV=1 64 337 8.0E-10
sp|A4VT40|TRUA_STRSY tRNA pseudouridine synthase A OS=Streptococcus suis (strain 05ZYH33) GN=truA PE=3 SV=1 61 326 9.0E-10
sp|Q93NE2|TRUA_MYXXA tRNA pseudouridine synthase A OS=Myxococcus xanthus GN=truA PE=3 SV=1 64 341 1.0E-09
sp|Q0HKB3|TRUA_SHESM tRNA pseudouridine synthase A OS=Shewanella sp. (strain MR-4) GN=truA PE=3 SV=1 64 347 1.0E-09
sp|P60351|TRUA_ONYPE tRNA pseudouridine synthase A OS=Onion yellows phytoplasma (strain OY-M) GN=truA PE=3 SV=1 63 329 1.0E-09
sp|Q0BAC2|TRUA_BURCM tRNA pseudouridine synthase A OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=truA PE=3 SV=1 64 356 2.0E-09
sp|B1Z1N7|TRUA_BURA4 tRNA pseudouridine synthase A OS=Burkholderia ambifaria (strain MC40-6) GN=truA PE=3 SV=1 64 356 2.0E-09
sp|Q084R8|TRUA_SHEFN tRNA pseudouridine synthase A OS=Shewanella frigidimarina (strain NCIMB 400) GN=truA PE=3 SV=1 64 341 2.0E-09
sp|Q6AKP0|TRUA2_DESPS tRNA pseudouridine synthase A 2 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=truA2 PE=3 SV=1 63 326 2.0E-09
sp|Q7TU07|TRUA_RHOBA tRNA pseudouridine synthase A OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=truA PE=3 SV=1 62 337 2.0E-09
sp|Q8K9U4|TRUA_BUCAP tRNA pseudouridine synthase A OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=truA PE=3 SV=1 65 294 2.0E-09
sp|Q393X8|TRUA_BURL3 tRNA pseudouridine synthase A OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=truA PE=3 SV=1 64 356 2.0E-09
sp|Q73E17|TRUA2_BACC1 tRNA pseudouridine synthase A 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=truA2 PE=3 SV=1 121 344 2.0E-09
sp|B0VLA5|TRUA_ACIBS tRNA pseudouridine synthase A OS=Acinetobacter baumannii (strain SDF) GN=truA PE=3 SV=1 65 327 2.0E-09
sp|A3M1T4|TRUA_ACIBT tRNA pseudouridine synthase A OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=truA PE=3 SV=2 65 327 2.0E-09
sp|Q8CY46|TRUA_BIFLO tRNA pseudouridine synthase A OS=Bifidobacterium longum (strain NCC 2705) GN=truA PE=3 SV=1 66 250 2.0E-09
sp|B3DQE2|TRUA_BIFLD tRNA pseudouridine synthase A OS=Bifidobacterium longum (strain DJO10A) GN=truA PE=3 SV=1 66 250 2.0E-09
sp|Q9X1R0|TRUA_THEMA tRNA pseudouridine synthase A OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=truA PE=3 SV=1 64 337 3.0E-09
sp|B9K8Q0|TRUA_THENN tRNA pseudouridine synthase A OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=truA PE=3 SV=1 62 340 3.0E-09
sp|A8LNZ7|TRUA_DINSH tRNA pseudouridine synthase A OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=truA PE=3 SV=1 64 343 4.0E-09
sp|A5IM09|TRUA_THEP1 tRNA pseudouridine synthase A OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=truA PE=3 SV=1 64 337 4.0E-09
sp|Q668W9|TRUA_YERPS tRNA pseudouridine synthase A OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=truA PE=3 SV=2 64 360 5.0E-09
sp|Q8ZD27|TRUA_YERPE tRNA pseudouridine synthase A OS=Yersinia pestis GN=truA PE=3 SV=1 64 360 5.0E-09
sp|A7FGM1|TRUA_YERP3 tRNA pseudouridine synthase A OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=truA PE=3 SV=1 64 360 5.0E-09
sp|A1RIB0|TRUA_SHESW tRNA pseudouridine synthase A OS=Shewanella sp. (strain W3-18-1) GN=truA PE=3 SV=1 64 344 5.0E-09
sp|B1LB83|TRUA_THESQ tRNA pseudouridine synthase A OS=Thermotoga sp. (strain RQ2) GN=truA PE=3 SV=1 64 337 5.0E-09
sp|A3N0R2|TRUA_ACTP2 tRNA pseudouridine synthase A OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=truA PE=3 SV=1 64 337 5.0E-09
sp|A3D666|TRUA_SHEB5 tRNA pseudouridine synthase A OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=truA PE=3 SV=1 64 344 6.0E-09
sp|Q5FPX3|TRUA_GLUOX tRNA pseudouridine synthase A OS=Gluconobacter oxydans (strain 621H) GN=truA PE=3 SV=1 65 324 6.0E-09
sp|Q6HNW5|TRUA2_BACHK tRNA pseudouridine synthase A 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=truA2 PE=3 SV=1 121 344 7.0E-09
sp|B4SA76|TRUA_PELPB tRNA pseudouridine synthase A OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=truA PE=3 SV=1 64 248 7.0E-09
sp|A0AZ67|TRUA_BURCH tRNA pseudouridine synthase A OS=Burkholderia cenocepacia (strain HI2424) GN=truA PE=3 SV=1 64 356 7.0E-09
sp|B1K370|TRUA_BURCC tRNA pseudouridine synthase A OS=Burkholderia cenocepacia (strain MC0-3) GN=truA PE=3 SV=1 64 356 7.0E-09
sp|Q1BM62|TRUA_BURCA tRNA pseudouridine synthase A OS=Burkholderia cenocepacia (strain AU 1054) GN=truA PE=3 SV=1 64 356 7.0E-09
sp|Q6I3T8|TRUA2_BACAN tRNA pseudouridine synthase A 2 OS=Bacillus anthracis GN=truA2 PE=3 SV=1 121 344 7.0E-09
sp|Q5LNR0|TRUA_RUEPO tRNA pseudouridine synthase A OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=truA PE=3 SV=1 65 343 7.0E-09
sp|Q63GF1|TRUA2_BACCZ tRNA pseudouridine synthase A 2 OS=Bacillus cereus (strain ZK / E33L) GN=truA2 PE=3 SV=1 121 344 7.0E-09
sp|B8EEB7|TRUA_SHEB2 tRNA pseudouridine synthase A OS=Shewanella baltica (strain OS223) GN=truA PE=3 SV=1 64 344 7.0E-09
sp|A9KTU7|TRUA_SHEB9 tRNA pseudouridine synthase A OS=Shewanella baltica (strain OS195) GN=truA PE=3 SV=1 64 344 7.0E-09
sp|B0V4L0|TRUA_ACIBY tRNA pseudouridine synthase A OS=Acinetobacter baumannii (strain AYE) GN=truA PE=3 SV=1 65 327 8.0E-09
sp|B7I4E8|TRUA_ACIB5 tRNA pseudouridine synthase A OS=Acinetobacter baumannii (strain AB0057) GN=truA PE=3 SV=1 65 327 8.0E-09
sp|B7H0S9|TRUA_ACIB3 tRNA pseudouridine synthase A OS=Acinetobacter baumannii (strain AB307-0294) GN=truA PE=3 SV=1 65 327 8.0E-09
sp|A4Y879|TRUA_SHEPC tRNA pseudouridine synthase A OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=truA PE=3 SV=1 64 344 8.0E-09
sp|A6WQ04|TRUA_SHEB8 tRNA pseudouridine synthase A OS=Shewanella baltica (strain OS185) GN=truA PE=3 SV=1 64 344 9.0E-09
sp|B2UNB6|TRUA_AKKM8 tRNA pseudouridine synthase A OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=truA PE=3 SV=1 64 247 9.0E-09
sp|Q12211|PUS1_YEAST tRNA pseudouridine synthase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUS1 PE=1 SV=1 62 425 1.0E-08
sp|Q1GE00|TRUA_RUEST tRNA pseudouridine synthase A OS=Ruegeria sp. (strain TM1040) GN=truA PE=3 SV=1 64 366 1.0E-08
sp|B4U9D9|TRUA_HYDS0 tRNA pseudouridine synthase A OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=truA PE=3 SV=1 68 246 2.0E-08
sp|Q2J2C4|TRUA_RHOP2 tRNA pseudouridine synthase A OS=Rhodopseudomonas palustris (strain HaA2) GN=truA PE=3 SV=1 66 326 3.0E-08
sp|B0SJC4|TRUA_LEPBP tRNA pseudouridine synthase A OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=truA PE=3 SV=1 65 344 4.0E-08
sp|B0SC03|TRUA_LEPBA tRNA pseudouridine synthase A OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=truA PE=3 SV=1 65 344 4.0E-08
sp|B2RIV6|TRUA_PORG3 tRNA pseudouridine synthase A OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=truA PE=3 SV=1 66 326 6.0E-08
sp|Q3SHL7|TRUA_THIDA tRNA pseudouridine synthase A OS=Thiobacillus denitrificans (strain ATCC 25259) GN=truA PE=3 SV=1 64 337 6.0E-08
sp|A3PF23|TRUA_PROM0 tRNA pseudouridine synthase A OS=Prochlorococcus marinus (strain MIT 9301) GN=truA PE=3 SV=1 64 335 9.0E-08
sp|Q21B58|TRUA_RHOPB tRNA pseudouridine synthase A OS=Rhodopseudomonas palustris (strain BisB18) GN=truA PE=3 SV=1 66 326 9.0E-08
sp|Q89BP1|TRUA_BRADU tRNA pseudouridine synthase A OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=truA PE=3 SV=2 66 326 1.0E-07
sp|Q07TX2|TRUA_RHOP5 tRNA pseudouridine synthase A OS=Rhodopseudomonas palustris (strain BisA53) GN=truA PE=3 SV=1 66 326 1.0E-07
sp|Q0SPF2|TRUA_BORAP tRNA pseudouridine synthase A OS=Borrelia afzelii (strain PKo) GN=truA PE=3 SV=1 64 337 1.0E-07
sp|A4YLC1|TRUA_BRASO tRNA pseudouridine synthase A OS=Bradyrhizobium sp. (strain ORS278) GN=truA PE=3 SV=1 66 326 2.0E-07
sp|Q6AD25|TRUA_LEIXX tRNA pseudouridine synthase A OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=truA PE=3 SV=1 60 246 2.0E-07
sp|Q30XU3|TRUA_DESAG tRNA pseudouridine synthase A OS=Desulfovibrio alaskensis (strain G20) GN=truA PE=3 SV=1 64 337 3.0E-07
sp|Q6A6S8|TRUA_PROAC tRNA pseudouridine synthase A OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=truA PE=3 SV=1 66 246 3.0E-07
sp|Q7MBB9|TRUA_GLOVI tRNA pseudouridine synthase A OS=Gloeobacter violaceus (strain PCC 7421) GN=truA PE=3 SV=1 64 326 6.0E-07
sp|Q0ASJ7|TRUA_MARMM tRNA pseudouridine synthase A OS=Maricaulis maris (strain MCS10) GN=truA PE=3 SV=1 66 257 1.0E-06
sp|Q8N0Z8|PUSL1_HUMAN tRNA pseudouridine synthase-like 1 OS=Homo sapiens GN=PUSL1 PE=1 SV=1 109 374 1.0E-06
sp|Q9X796|TRUA_MYCLE tRNA pseudouridine synthase A OS=Mycobacterium leprae (strain TN) GN=truA PE=3 SV=2 66 355 1.0E-06
sp|B8DRQ6|TRUA_DESVM tRNA pseudouridine synthase A OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=truA PE=3 SV=1 64 357 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0009451 RNA modification Yes
GO:0001522 pseudouridine synthesis Yes
GO:0009982 pseudouridine synthase activity Yes
GO:0006807 nitrogen compound metabolic process No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0043412 macromolecule modification No
GO:0009987 cellular process No
GO:0046483 heterocycle metabolic process No
GO:0016853 isomerase activity No
GO:0043170 macromolecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0005488 binding No
GO:0071704 organic substance metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016866 intramolecular transferase activity No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0016070 RNA metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1563
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6596 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6124
Ophiocordyceps camponoti-floridani Ophcf2|05820
Ophiocordyceps camponoti-rufipedis Ophun1|739
Ophiocordyceps kimflemingae Ophio5|5761
Ophiocordyceps subramaniannii Hirsu2|1145

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6596
MSGLDDYEQWTKSSLIARVRHLESQLDESGRLGALADKTRPDKTRPDKTTRREMDASKYSTRFIALKLAYLGKNY
GGFEFQPSGNLPSIEEELWKALTRACLIFPNDNKLVKFDCCDYSKCGRTDRGVSAFGQVIALRVRSNRPRLHQGE
PLQFDHVDDELCYPRLLNRILPQDIRVLAWCPWLPADFSARFSCRERQYRYFFTQPALAPLPSHSSSVKTEWLDI
EAMRDAAKRFQGEHDFRNFCKLDPAKQITNFSRRIFEADIVQVQDDGSTLAYLQDAGFAPPGIPVPDATHLRIFY
FHVRGSAFLWHQIRHMVAILFLVGQGLEQPSLVSELLNVQKHAQKPNYVMADYLPLVLWDCVFSGDSHGDDQGPA
KDSLDWIYIGDDKLKSKFGKFGLVHDIWALWRQHKMDEVLANQLLRQVSAPRRTRDEPSYQLPSAGATAAGVKVF
DGGNRGRYEGRYVAVMDKKLLQTVEEQNDKYAKRKGYANAQDMWTRRAEDRARLDKACAQEE*
Coding >OphauG2|6596
ATGTCGGGCTTGGACGACTACGAGCAATGGACCAAGAGCAGTCTCATAGCAAGAGTCAGGCACCTGGAGAGTCAG
CTCGACGAGTCGGGACGGCTTGGGGCGTTGGCCGACAAGACGCGACCCGACAAGACGCGACCCGACAAGACGACG
CGACGCGAGATGGATGCTTCAAAGTACTCGACGCGCTTCATTGCGCTCAAGCTGGCTTATCTGGGCAAGAATTAC
GGCGGCTTCGAGTTCCAGCCGTCGGGAAATCTGCCCTCGATTGAGGAGGAGTTGTGGAAAGCTCTGACGCGGGCT
TGTCTTATTTTCCCCAACGACAACAAGCTGGTCAAGTTTGACTGCTGCGACTACTCCAAATGCGGGCGCACAGAC
CGAGGAGTAAGCGCTTTTGGACAGGTGATTGCGTTGCGCGTGAGGAGCAACAGGCCCCGGCTGCACCAAGGCGAG
CCGCTTCAATTTGACCACGTCGACGACGAGCTCTGCTACCCGCGCCTCCTCAACCGCATACTCCCCCAAGACATC
CGCGTCTTGGCGTGGTGTCCTTGGCTGCCAGCAGATTTCTCGGCGCGCTTCTCATGTCGTGAGCGCCAGTATCGC
TACTTTTTTACCCAGCCAGCCCTTGCCCCTCTTCCCTCACACTCGTCGAGCGTCAAGACGGAATGGCTCGACATT
GAAGCCATGCGCGACGCGGCCAAGCGCTTCCAAGGCGAACACGACTTTCGCAACTTTTGCAAGCTGGATCCAGCC
AAGCAAATCACAAACTTTTCCAGGCGCATATTCGAGGCAGATATTGTCCAAGTCCAAGACGACGGCTCCACACTT
GCCTACCTGCAAGACGCTGGTTTCGCGCCCCCAGGCATTCCAGTGCCAGACGCCACACACCTGCGCATCTTTTAC
TTTCACGTCCGCGGCTCGGCTTTTTTGTGGCATCAGATTCGACACATGGTTGCCATTCTTTTCCTTGTCGGCCAG
GGGCTCGAGCAGCCGTCGCTCGTGTCGGAGCTGCTCAATGTTCAAAAACATGCACAGAAGCCAAACTACGTCATG
GCCGATTATCTGCCTCTTGTGCTTTGGGACTGCGTCTTCTCTGGCGACAGCCATGGCGACGACCAAGGTCCAGCC
AAGGATTCGCTTGACTGGATATATATTGGCGACGACAAGCTGAAGAGCAAGTTTGGCAAGTTTGGTCTCGTCCAT
GATATTTGGGCCTTGTGGCGGCAGCACAAAATGGATGAAGTGCTGGCAAACCAGCTCCTGCGCCAAGTCTCGGCA
CCGAGGCGAACAAGAGACGAGCCAAGCTATCAGCTGCCAAGCGCTGGCGCCACCGCGGCAGGTGTCAAGGTCTTT
GACGGTGGCAATCGCGGACGCTACGAGGGCCGATATGTGGCAGTCATGGACAAGAAGCTTTTGCAGACAGTCGAG
GAGCAGAACGACAAGTACGCCAAGCGCAAGGGCTATGCTAATGCCCAAGACATGTGGACACGGAGAGCTGAGGAC
AGGGCGAGACTGGACAAGGCTTGCGCCCAAGAGGAGTGA
Transcript >OphauG2|6596
ATGTCGGGCTTGGACGACTACGAGCAATGGACCAAGAGCAGTCTCATAGCAAGAGTCAGGCACCTGGAGAGTCAG
CTCGACGAGTCGGGACGGCTTGGGGCGTTGGCCGACAAGACGCGACCCGACAAGACGCGACCCGACAAGACGACG
CGACGCGAGATGGATGCTTCAAAGTACTCGACGCGCTTCATTGCGCTCAAGCTGGCTTATCTGGGCAAGAATTAC
GGCGGCTTCGAGTTCCAGCCGTCGGGAAATCTGCCCTCGATTGAGGAGGAGTTGTGGAAAGCTCTGACGCGGGCT
TGTCTTATTTTCCCCAACGACAACAAGCTGGTCAAGTTTGACTGCTGCGACTACTCCAAATGCGGGCGCACAGAC
CGAGGAGTAAGCGCTTTTGGACAGGTGATTGCGTTGCGCGTGAGGAGCAACAGGCCCCGGCTGCACCAAGGCGAG
CCGCTTCAATTTGACCACGTCGACGACGAGCTCTGCTACCCGCGCCTCCTCAACCGCATACTCCCCCAAGACATC
CGCGTCTTGGCGTGGTGTCCTTGGCTGCCAGCAGATTTCTCGGCGCGCTTCTCATGTCGTGAGCGCCAGTATCGC
TACTTTTTTACCCAGCCAGCCCTTGCCCCTCTTCCCTCACACTCGTCGAGCGTCAAGACGGAATGGCTCGACATT
GAAGCCATGCGCGACGCGGCCAAGCGCTTCCAAGGCGAACACGACTTTCGCAACTTTTGCAAGCTGGATCCAGCC
AAGCAAATCACAAACTTTTCCAGGCGCATATTCGAGGCAGATATTGTCCAAGTCCAAGACGACGGCTCCACACTT
GCCTACCTGCAAGACGCTGGTTTCGCGCCCCCAGGCATTCCAGTGCCAGACGCCACACACCTGCGCATCTTTTAC
TTTCACGTCCGCGGCTCGGCTTTTTTGTGGCATCAGATTCGACACATGGTTGCCATTCTTTTCCTTGTCGGCCAG
GGGCTCGAGCAGCCGTCGCTCGTGTCGGAGCTGCTCAATGTTCAAAAACATGCACAGAAGCCAAACTACGTCATG
GCCGATTATCTGCCTCTTGTGCTTTGGGACTGCGTCTTCTCTGGCGACAGCCATGGCGACGACCAAGGTCCAGCC
AAGGATTCGCTTGACTGGATATATATTGGCGACGACAAGCTGAAGAGCAAGTTTGGCAAGTTTGGTCTCGTCCAT
GATATTTGGGCCTTGTGGCGGCAGCACAAAATGGATGAAGTGCTGGCAAACCAGCTCCTGCGCCAAGTCTCGGCA
CCGAGGCGAACAAGAGACGAGCCAAGCTATCAGCTGCCAAGCGCTGGCGCCACCGCGGCAGGTGTCAAGGTCTTT
GACGGTGGCAATCGCGGACGCTACGAGGGCCGATATGTGGCAGTCATGGACAAGAAGCTTTTGCAGACAGTCGAG
GAGCAGAACGACAAGTACGCCAAGCGCAAGGGCTATGCTAATGCCCAAGACATGTGGACACGGAGAGCTGAGGAC
AGGGCGAGACTGGACAAGGCTTGCGCCCAAGAGGAGTGA
Gene >OphauG2|6596
ATGTCGGGCTTGGACGACTACGAGCAATGGACCAAGAGCAGTCTCATAGCAAGAGTCAGGCACCTGGAGAGTCAG
CTCGACGAGTCGGGACGGCTTGGGGCGTTGGCCGACAAGACGCGACCCGACAAGACGCGACCCGACAAGACGACG
CGACGCGAGATGGATGCTTCAAAGTACTCGACGCGCTTCATTGCGCTCAAGCTGGCTTATCTGGGCAAGAATTAC
GGCGGCTTCGAGTTCCAGCCGTCGGGAAATCTGCCCTCGATTGAGGAGGAGTTGTGGAAAGCTCTGACGCGGGCT
TGTCTTATTTTCCCCAACGACAACAAGCTGGTCAAGTTTGACTGCTGCGACTACTCCAAATGCGGGCGCACAGAC
CGAGGAGTAAGCGCTTTTGGACAGGTGATTGCGTTGCGCGTGAGGAGCAACAGGCCCCGGCTGCACCAAGGCGAG
CCGCTTCAATTTGACCACGTCGACGACGAGCTCTGCTACCCGCGCCTCCTCAACCGCATACTCCCCCAAGACATC
CGCGTCTTGGCGTGGTGTCCTTGGCTGCCAGCAGATTTCTCGGCGCGCTTCTCATGTCGTGAGCGCCAGTATCGC
TACTTTTTTACCCAGCCAGCCCTTGCCCCTCTTCCCTCACACTCGTCGAGCGTCAAGACGGAATGGCTCGACATT
GAAGCCATGCGCGACGCGGCCAAGCGCTTCCAAGGCGAACACGACTTTCGCAACTTTTGCAAGCTGGATCCAGCC
AAGCAAATCACAAACTTTTCCAGGCGCATATTCGAGGCAGATATTGTCCAAGTCCAAGACGACGGCTCCACACTT
GCCTACCTGCAAGACGCTGGTTTCGCGCCCCCAGGCATTCCAGTGCCAGACGCCACACACCTGCGCATCTTTTAC
TTTCACGTCCGCGGCTCGGCTTTTTTGTGGCATCAGATTCGACACATGGTTGCCATTCTTTTCCTTGTCGGCCAG
GGGCTCGAGCAGCCGTCGCTCGTGTCGGAGCTGCTCAATGTTCAAAAACATGCACAGAAGCCAAACTACGTCATG
GCCGATTATCTGCCTCTTGTGCTTTGGGACTGCGTCTTCTCTGGCGACAGCCATGGCGACGACCAAGGTCCAGCC
AAGGATTCGCTTGACTGGATATATATTGGCGACGACAAGCTGAAGAGCAAGTTTGGCAAGTTTGGTCTCGTCCAT
GATATTTGGGCCTTGTGGCGGCAGCACAAAATGGATGAAGTGCTGGCAAACCAGCTCCTGCGCCAAGTCTCGGCA
CCGAGGCGAACAAGAGACGAGCCAAGCTATCAGCTGCCAAGCGCTGGCGCCACCGCGGCAGGTGTCAAGGTCTTT
GACGGTGGCAATCGCGGACGCTACGAGGGCCGATATGTGGCAGTCATGGACAAGAAGCTTTTGCAGACAGTCGAG
GAGCAGAACGACAAGTACGCCAAGCGCAAGGGCTATGCTAATGCCCAAGACATGTGGACACGGAGAGCTGAGGAC
AGGGCGAGACTGGACAAGGCTTGCGCCCAAGAGGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail