Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6590
Gene name
LocationContig_692:7009..8953
Strand+
Gene length (bp)1944
Transcript length (bp)1944
Coding sequence length (bp)1944
Protein length (aa) 648

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09243 Rsm22 Mitochondrial small ribosomal subunit Rsm22 7.8E-07 277 340
PF09243 Rsm22 Mitochondrial small ribosomal subunit Rsm22 2.2E-18 375 530

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q86ZU7|CO112_SCHPO Rsm22-cox11 tandem protein 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cox1102 PE=1 SV=2 146 537 1.0E-25
sp|Q9UTM2|CO111_SCHPO Rsm22-cox11 tandem protein 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cox1101 PE=1 SV=2 146 537 1.0E-25
sp|P36056|RT22_YEAST 37S ribosomal protein S22, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSM22 PE=1 SV=1 141 604 1.0E-23
sp|Q2TBP8|MET17_BOVIN Methyltransferase-like protein 17, mitochondrial OS=Bos taurus GN=METTL17 PE=2 SV=1 278 539 8.0E-08

GO

GO Term Description Terminal node
GO:0006412 translation Yes
GO:0008168 methyltransferase activity Yes
GO:0006807 nitrogen compound metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0043603 cellular amide metabolic process No
GO:0009987 cellular process No
GO:0043170 macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006518 peptide metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043604 amide biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0044260 cellular macromolecule metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0043043 peptide biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2392
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6590 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1497
Ophiocordyceps camponoti-floridani Ophcf2|00996
Ophiocordyceps camponoti-rufipedis Ophun1|297
Ophiocordyceps kimflemingae Ophio5|7926
Ophiocordyceps subramaniannii Hirsu2|3377

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6590
MRNIRSRGRISKARREKIPGQEDAVFSDDYVEIPFQGDHPEWLESGRDQELYRWTDSVKKRYHPNTLDAKFVGSP
RQIQIPEVNLLEGLRAELTGVSTKRLRERCEELYGGPGLPFSLSPRYLKNYDQGHGLLAEYKGLNELDAKAFLAM
HLPPAYAAAFVILREVRRRLGPDWIQSRLVNKEVGEMSVLDVGGGGAAIAAWNEICDAEWGLLEERGMAHGPRPM
GENEGILVGSAPLRDHLKRMFPHVKFMSSLPDYAHSGSMYGDALDGGKEKQARKKYDVVIASHNLLTREKYWQRR
HLLYALWNLVDEKDGVLIVIERGDQRGAQAVGDIRDILLREVLLPQTGDKGTKHRERKLFNSTDKEEVRKGAKFE
RQVGHLIAPCTNHAPCPMWRANSTYIRDFCHFRYQYWMPTFYRNMISYKTEVRGPISGGGDVKFCYVAVRRGHAR
KSTLSGAEATDRAFEGYTSTEHKPDAQTLPRLIMPPLKRQGHICMDVCTPDAKIERWIVPKSHGHQAFHDVRKCS
WGDLWALGAKTRIPRKLELGGQNLAGRDEHKQARRWARVKKHEQLAMVAEGKARESLRVRRTQEYFEQLVDSGSL
KDEKDMEEEDEEEEDEEEEDEEEEDEEEKDEEDMEDIEDEDRIGTKK*
Coding >OphauG2|6590
ATGAGGAACATTCGTTCCAGGGGCAGGATATCCAAGGCTCGAAGGGAGAAAATTCCAGGCCAGGAGGACGCTGTG
TTTTCAGACGACTACGTGGAAATCCCGTTTCAAGGAGATCACCCCGAGTGGCTCGAATCGGGACGCGACCAAGAG
CTATACAGATGGACCGATTCTGTCAAGAAGAGATACCATCCCAACACTCTTGATGCCAAGTTTGTGGGAAGCCCG
CGGCAAATCCAAATCCCAGAAGTCAACCTCCTGGAAGGTCTCCGTGCCGAATTGACGGGTGTGTCGACAAAGCGG
CTGAGAGAGAGGTGTGAAGAACTTTATGGCGGCCCAGGGCTGCCCTTTTCATTATCACCGCGATACCTCAAAAAC
TACGACCAAGGCCACGGCTTGCTGGCAGAATACAAGGGGCTGAATGAATTGGATGCAAAGGCCTTTTTGGCGATG
CACCTGCCTCCGGCCTATGCGGCGGCATTTGTGATTTTGCGCGAGGTTCGCAGACGGCTGGGTCCTGACTGGATA
CAATCGCGACTTGTCAATAAGGAGGTGGGCGAGATGAGTGTGCTCGACGTTGGGGGAGGCGGAGCGGCGATTGCG
GCGTGGAACGAAATTTGCGATGCTGAATGGGGGCTGCTTGAAGAAAGAGGCATGGCGCATGGACCGCGACCAATG
GGGGAAAACGAGGGCATTTTGGTTGGGTCGGCGCCGTTGCGAGATCATCTGAAGCGAATGTTTCCGCATGTCAAG
TTTATGTCGTCGCTTCCCGACTATGCGCATTCGGGAAGCATGTACGGCGATGCTCTAGATGGGGGCAAGGAGAAA
CAGGCGCGAAAAAAGTATGACGTGGTGATTGCGTCACACAACTTGTTGACGCGAGAAAAGTACTGGCAACGGCGC
CACCTCTTGTACGCGCTCTGGAACTTGGTGGACGAGAAGGACGGAGTGTTGATTGTGATTGAGAGAGGCGATCAG
CGCGGGGCGCAGGCCGTGGGAGACATTCGAGACATCTTGCTGCGAGAGGTGTTGCTGCCGCAAACCGGGGATAAA
GGCACGAAGCATAGGGAGCGGAAGCTCTTCAACAGTACGGACAAGGAAGAGGTGAGAAAAGGGGCCAAGTTTGAG
CGTCAAGTAGGACACTTGATTGCGCCTTGCACCAACCACGCGCCGTGTCCCATGTGGCGGGCAAACTCTACATAT
ATTCGCGACTTTTGCCACTTTCGCTACCAATACTGGATGCCAACCTTTTACCGCAACATGATTAGCTACAAGACC
GAGGTCCGGGGGCCGATTAGCGGAGGCGGCGACGTCAAGTTTTGCTACGTGGCGGTTCGTCGGGGGCACGCGCGC
AAGAGCACACTGTCGGGGGCCGAAGCAACGGACCGGGCCTTTGAGGGCTACACGTCGACGGAGCACAAGCCCGAC
GCGCAGACGCTGCCGCGCTTAATCATGCCGCCGCTCAAGCGACAGGGCCACATTTGCATGGACGTGTGCACGCCC
GATGCCAAGATTGAGCGCTGGATTGTTCCCAAGAGCCACGGCCACCAAGCCTTTCACGATGTGCGCAAGTGTTCA
TGGGGAGATTTATGGGCGCTGGGAGCCAAGACGCGGATTCCGCGCAAGCTCGAGCTCGGGGGGCAAAATCTTGCA
GGCAGGGACGAGCACAAGCAGGCGCGGCGGTGGGCGCGGGTAAAGAAGCATGAGCAGCTTGCAATGGTGGCAGAA
GGCAAGGCGCGCGAGTCGTTGAGGGTGCGTCGGACACAGGAGTATTTTGAGCAGCTGGTGGATTCGGGGTCGTTG
AAGGATGAAAAGGATATGGAAGAGGAAGATGAGGAAGAGGAGGATGAGGAAGAGGAAGATGAGGAAGAGGAAGAC
GAGGAAGAGAAAGATGAGGAAGATATGGAAGATATAGAAGATGAGGATCGAATTGGGACGAAAAAGTAA
Transcript >OphauG2|6590
ATGAGGAACATTCGTTCCAGGGGCAGGATATCCAAGGCTCGAAGGGAGAAAATTCCAGGCCAGGAGGACGCTGTG
TTTTCAGACGACTACGTGGAAATCCCGTTTCAAGGAGATCACCCCGAGTGGCTCGAATCGGGACGCGACCAAGAG
CTATACAGATGGACCGATTCTGTCAAGAAGAGATACCATCCCAACACTCTTGATGCCAAGTTTGTGGGAAGCCCG
CGGCAAATCCAAATCCCAGAAGTCAACCTCCTGGAAGGTCTCCGTGCCGAATTGACGGGTGTGTCGACAAAGCGG
CTGAGAGAGAGGTGTGAAGAACTTTATGGCGGCCCAGGGCTGCCCTTTTCATTATCACCGCGATACCTCAAAAAC
TACGACCAAGGCCACGGCTTGCTGGCAGAATACAAGGGGCTGAATGAATTGGATGCAAAGGCCTTTTTGGCGATG
CACCTGCCTCCGGCCTATGCGGCGGCATTTGTGATTTTGCGCGAGGTTCGCAGACGGCTGGGTCCTGACTGGATA
CAATCGCGACTTGTCAATAAGGAGGTGGGCGAGATGAGTGTGCTCGACGTTGGGGGAGGCGGAGCGGCGATTGCG
GCGTGGAACGAAATTTGCGATGCTGAATGGGGGCTGCTTGAAGAAAGAGGCATGGCGCATGGACCGCGACCAATG
GGGGAAAACGAGGGCATTTTGGTTGGGTCGGCGCCGTTGCGAGATCATCTGAAGCGAATGTTTCCGCATGTCAAG
TTTATGTCGTCGCTTCCCGACTATGCGCATTCGGGAAGCATGTACGGCGATGCTCTAGATGGGGGCAAGGAGAAA
CAGGCGCGAAAAAAGTATGACGTGGTGATTGCGTCACACAACTTGTTGACGCGAGAAAAGTACTGGCAACGGCGC
CACCTCTTGTACGCGCTCTGGAACTTGGTGGACGAGAAGGACGGAGTGTTGATTGTGATTGAGAGAGGCGATCAG
CGCGGGGCGCAGGCCGTGGGAGACATTCGAGACATCTTGCTGCGAGAGGTGTTGCTGCCGCAAACCGGGGATAAA
GGCACGAAGCATAGGGAGCGGAAGCTCTTCAACAGTACGGACAAGGAAGAGGTGAGAAAAGGGGCCAAGTTTGAG
CGTCAAGTAGGACACTTGATTGCGCCTTGCACCAACCACGCGCCGTGTCCCATGTGGCGGGCAAACTCTACATAT
ATTCGCGACTTTTGCCACTTTCGCTACCAATACTGGATGCCAACCTTTTACCGCAACATGATTAGCTACAAGACC
GAGGTCCGGGGGCCGATTAGCGGAGGCGGCGACGTCAAGTTTTGCTACGTGGCGGTTCGTCGGGGGCACGCGCGC
AAGAGCACACTGTCGGGGGCCGAAGCAACGGACCGGGCCTTTGAGGGCTACACGTCGACGGAGCACAAGCCCGAC
GCGCAGACGCTGCCGCGCTTAATCATGCCGCCGCTCAAGCGACAGGGCCACATTTGCATGGACGTGTGCACGCCC
GATGCCAAGATTGAGCGCTGGATTGTTCCCAAGAGCCACGGCCACCAAGCCTTTCACGATGTGCGCAAGTGTTCA
TGGGGAGATTTATGGGCGCTGGGAGCCAAGACGCGGATTCCGCGCAAGCTCGAGCTCGGGGGGCAAAATCTTGCA
GGCAGGGACGAGCACAAGCAGGCGCGGCGGTGGGCGCGGGTAAAGAAGCATGAGCAGCTTGCAATGGTGGCAGAA
GGCAAGGCGCGCGAGTCGTTGAGGGTGCGTCGGACACAGGAGTATTTTGAGCAGCTGGTGGATTCGGGGTCGTTG
AAGGATGAAAAGGATATGGAAGAGGAAGATGAGGAAGAGGAGGATGAGGAAGAGGAAGATGAGGAAGAGGAAGAC
GAGGAAGAGAAAGATGAGGAAGATATGGAAGATATAGAAGATGAGGATCGAATTGGGACGAAAAAGTAA
Gene >OphauG2|6590
ATGAGGAACATTCGTTCCAGGGGCAGGATATCCAAGGCTCGAAGGGAGAAAATTCCAGGCCAGGAGGACGCTGTG
TTTTCAGACGACTACGTGGAAATCCCGTTTCAAGGAGATCACCCCGAGTGGCTCGAATCGGGACGCGACCAAGAG
CTATACAGATGGACCGATTCTGTCAAGAAGAGATACCATCCCAACACTCTTGATGCCAAGTTTGTGGGAAGCCCG
CGGCAAATCCAAATCCCAGAAGTCAACCTCCTGGAAGGTCTCCGTGCCGAATTGACGGGTGTGTCGACAAAGCGG
CTGAGAGAGAGGTGTGAAGAACTTTATGGCGGCCCAGGGCTGCCCTTTTCATTATCACCGCGATACCTCAAAAAC
TACGACCAAGGCCACGGCTTGCTGGCAGAATACAAGGGGCTGAATGAATTGGATGCAAAGGCCTTTTTGGCGATG
CACCTGCCTCCGGCCTATGCGGCGGCATTTGTGATTTTGCGCGAGGTTCGCAGACGGCTGGGTCCTGACTGGATA
CAATCGCGACTTGTCAATAAGGAGGTGGGCGAGATGAGTGTGCTCGACGTTGGGGGAGGCGGAGCGGCGATTGCG
GCGTGGAACGAAATTTGCGATGCTGAATGGGGGCTGCTTGAAGAAAGAGGCATGGCGCATGGACCGCGACCAATG
GGGGAAAACGAGGGCATTTTGGTTGGGTCGGCGCCGTTGCGAGATCATCTGAAGCGAATGTTTCCGCATGTCAAG
TTTATGTCGTCGCTTCCCGACTATGCGCATTCGGGAAGCATGTACGGCGATGCTCTAGATGGGGGCAAGGAGAAA
CAGGCGCGAAAAAAGTATGACGTGGTGATTGCGTCACACAACTTGTTGACGCGAGAAAAGTACTGGCAACGGCGC
CACCTCTTGTACGCGCTCTGGAACTTGGTGGACGAGAAGGACGGAGTGTTGATTGTGATTGAGAGAGGCGATCAG
CGCGGGGCGCAGGCCGTGGGAGACATTCGAGACATCTTGCTGCGAGAGGTGTTGCTGCCGCAAACCGGGGATAAA
GGCACGAAGCATAGGGAGCGGAAGCTCTTCAACAGTACGGACAAGGAAGAGGTGAGAAAAGGGGCCAAGTTTGAG
CGTCAAGTAGGACACTTGATTGCGCCTTGCACCAACCACGCGCCGTGTCCCATGTGGCGGGCAAACTCTACATAT
ATTCGCGACTTTTGCCACTTTCGCTACCAATACTGGATGCCAACCTTTTACCGCAACATGATTAGCTACAAGACC
GAGGTCCGGGGGCCGATTAGCGGAGGCGGCGACGTCAAGTTTTGCTACGTGGCGGTTCGTCGGGGGCACGCGCGC
AAGAGCACACTGTCGGGGGCCGAAGCAACGGACCGGGCCTTTGAGGGCTACACGTCGACGGAGCACAAGCCCGAC
GCGCAGACGCTGCCGCGCTTAATCATGCCGCCGCTCAAGCGACAGGGCCACATTTGCATGGACGTGTGCACGCCC
GATGCCAAGATTGAGCGCTGGATTGTTCCCAAGAGCCACGGCCACCAAGCCTTTCACGATGTGCGCAAGTGTTCA
TGGGGAGATTTATGGGCGCTGGGAGCCAAGACGCGGATTCCGCGCAAGCTCGAGCTCGGGGGGCAAAATCTTGCA
GGCAGGGACGAGCACAAGCAGGCGCGGCGGTGGGCGCGGGTAAAGAAGCATGAGCAGCTTGCAATGGTGGCAGAA
GGCAAGGCGCGCGAGTCGTTGAGGGTGCGTCGGACACAGGAGTATTTTGAGCAGCTGGTGGATTCGGGGTCGTTG
AAGGATGAAAAGGATATGGAAGAGGAAGATGAGGAAGAGGAGGATGAGGAAGAGGAAGATGAGGAAGAGGAAGAC
GAGGAAGAGAAAGATGAGGAAGATATGGAAGATATAGAAGATGAGGATCGAATTGGGACGAAAAAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail