Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6588
Gene name
LocationContig_692:3672..4808
Strand-
Gene length (bp)1136
Transcript length (bp)999
Coding sequence length (bp)999
Protein length (aa) 333

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02598 Methyltrn_RNA_3 Putative RNA methyltransferase 1.6E-99 32 325

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5T280|CI114_HUMAN Putative methyltransferase C9orf114 OS=Homo sapiens GN=C9orf114 PE=1 SV=3 28 331 1.0E-75
sp|Q3UHX9|CI114_MOUSE Putative methyltransferase C9orf114 homolog OS=Mus musculus GN=D2Wsu81e PE=1 SV=1 28 326 7.0E-75
sp|Q10950|YMP6_CAEEL Putative methyltransferase B0361.6 OS=Caenorhabditis elegans GN=B0361.6 PE=3 SV=1 31 326 2.0E-35
sp|O13641|YGWG_SCHPO Putative methyltransferase SPBC8D2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi049 PE=3 SV=1 29 267 9.0E-27
sp|Q06847|Y1688_HALSA Uncharacterized protein VNG_1688C OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=VNG_1688C PE=4 SV=2 32 325 3.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5T280|CI114_HUMAN Putative methyltransferase C9orf114 OS=Homo sapiens GN=C9orf114 PE=1 SV=3 28 331 1.0E-75
sp|Q3UHX9|CI114_MOUSE Putative methyltransferase C9orf114 homolog OS=Mus musculus GN=D2Wsu81e PE=1 SV=1 28 326 7.0E-75
sp|Q10950|YMP6_CAEEL Putative methyltransferase B0361.6 OS=Caenorhabditis elegans GN=B0361.6 PE=3 SV=1 31 326 2.0E-35
sp|O13641|YGWG_SCHPO Putative methyltransferase SPBC8D2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi049 PE=3 SV=1 29 267 9.0E-27
sp|Q06847|Y1688_HALSA Uncharacterized protein VNG_1688C OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=VNG_1688C PE=4 SV=2 32 325 3.0E-08
sp|P20571|Y1612_HALMA Uncharacterized protein rrnAC1612 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rrnAC1612 PE=4 SV=2 32 325 5.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6588
MQKRKTAHNGQDKSSFKPSASFAPLHGGRTWTVSVAVASSVLASLPTADQRMALAGRLARALAVFSIDEAIVFDD
SPSSSRPRSLDTAAYTGDIDAAHFLAHILSFLEAPPFMRKALFPLHPNLRLTALLPSLDMPHHPHPKESLVYREG
VTLDRPTSSAKGSLVEIGADSPVEIAESLPPKTRLTLRLDGDGAPECVDPTAPRVHGGYYWGYSVRKAPSLSAVF
TESPFEEGYDVSIGTSERGIAVSQAFPQSARPLDFEHLLIVFGGPRGLEFASMNDEELVGRDVQGPRTRDLFDHW
VNVLPNQGSRTIRTEEALLIALTALRGLWDAS*
Coding >OphauG2|6588
ATGCAGAAGCGAAAGACGGCACACAATGGCCAGGACAAGAGCTCGTTTAAGCCGTCTGCTAGCTTTGCGCCTCTG
CACGGCGGCCGCACCTGGACAGTCTCTGTGGCTGTAGCAAGCAGCGTTTTGGCCAGCCTCCCCACCGCCGACCAG
CGCATGGCCCTCGCAGGCCGCCTCGCCCGCGCCCTCGCCGTCTTTAGCATCGACGAAGCCATCGTCTTTGACGAC
TCGCCCTCGTCTTCACGCCCTCGCTCTCTCGACACGGCCGCCTACACTGGTGACATTGATGCCGCCCACTTCCTC
GCCCACATTCTCTCCTTTCTCGAAGCTCCGCCCTTTATGCGCAAGGCTCTTTTCCCCCTACACCCCAATCTGCGC
CTCACCGCCCTTCTTCCTAGTCTCGACATGCCCCATCACCCGCATCCCAAGGAATCTCTCGTCTATCGCGAAGGC
GTCACCCTCGACCGCCCAACCTCGTCGGCAAAGGGCTCCCTCGTTGAGATTGGCGCAGACAGCCCCGTCGAGATT
GCAGAGTCGTTGCCGCCAAAGACGCGGCTTACCCTACGCCTCGATGGCGACGGCGCCCCAGAGTGTGTTGATCCT
ACTGCGCCCCGTGTCCACGGCGGCTATTACTGGGGGTACTCGGTTCGCAAGGCTCCCTCGCTTTCCGCAGTCTTT
ACCGAGTCGCCGTTTGAAGAGGGCTACGACGTTAGCATCGGCACCTCGGAGCGAGGCATTGCGGTCTCTCAGGCC
TTCCCCCAGTCGGCGCGTCCACTCGACTTTGAGCATTTGCTCATTGTCTTTGGCGGCCCGCGCGGTCTCGAGTTT
GCTTCAATGAATGATGAGGAGCTGGTTGGTAGAGATGTTCAGGGCCCAAGGACGCGGGACCTGTTTGACCATTGG
GTCAATGTGCTGCCCAACCAAGGAAGCAGAACGATTAGAACCGAGGAGGCGCTCTTGATTGCGCTTACTGCTCTG
CGGGGACTTTGGGATGCGTCCTAG
Transcript >OphauG2|6588
ATGCAGAAGCGAAAGACGGCACACAATGGCCAGGACAAGAGCTCGTTTAAGCCGTCTGCTAGCTTTGCGCCTCTG
CACGGCGGCCGCACCTGGACAGTCTCTGTGGCTGTAGCAAGCAGCGTTTTGGCCAGCCTCCCCACCGCCGACCAG
CGCATGGCCCTCGCAGGCCGCCTCGCCCGCGCCCTCGCCGTCTTTAGCATCGACGAAGCCATCGTCTTTGACGAC
TCGCCCTCGTCTTCACGCCCTCGCTCTCTCGACACGGCCGCCTACACTGGTGACATTGATGCCGCCCACTTCCTC
GCCCACATTCTCTCCTTTCTCGAAGCTCCGCCCTTTATGCGCAAGGCTCTTTTCCCCCTACACCCCAATCTGCGC
CTCACCGCCCTTCTTCCTAGTCTCGACATGCCCCATCACCCGCATCCCAAGGAATCTCTCGTCTATCGCGAAGGC
GTCACCCTCGACCGCCCAACCTCGTCGGCAAAGGGCTCCCTCGTTGAGATTGGCGCAGACAGCCCCGTCGAGATT
GCAGAGTCGTTGCCGCCAAAGACGCGGCTTACCCTACGCCTCGATGGCGACGGCGCCCCAGAGTGTGTTGATCCT
ACTGCGCCCCGTGTCCACGGCGGCTATTACTGGGGGTACTCGGTTCGCAAGGCTCCCTCGCTTTCCGCAGTCTTT
ACCGAGTCGCCGTTTGAAGAGGGCTACGACGTTAGCATCGGCACCTCGGAGCGAGGCATTGCGGTCTCTCAGGCC
TTCCCCCAGTCGGCGCGTCCACTCGACTTTGAGCATTTGCTCATTGTCTTTGGCGGCCCGCGCGGTCTCGAGTTT
GCTTCAATGAATGATGAGGAGCTGGTTGGTAGAGATGTTCAGGGCCCAAGGACGCGGGACCTGTTTGACCATTGG
GTCAATGTGCTGCCCAACCAAGGAAGCAGAACGATTAGAACCGAGGAGGCGCTCTTGATTGCGCTTACTGCTCTG
CGGGGACTTTGGGATGCGTCCTAG
Gene >OphauG2|6588
ATGCAGAAGCGAAAGACGGCACACAATGGCCAGGACAAGAGCTCGTTTAAGCCGTCTGCTAGCTTTGCGCCTCTG
CACGGCGGCCGCACCTGGACAGTCTCTGTGGCTGTAGCAAGCAGCGTTTTGGCCAGGTACAGCAGCCTCTCTCTC
TCTCTCTCTCTCTCTCTGTCTCTATCTCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNAAAAAAAAAAAAAACTTGGGGCTGATTGCATCTAGCCTCCCCACCGCCGACCAGCGCATGGCCCTCG
CAGGCCGCCTCGCCCGCGCCCTCGCCGTCTTTAGCATCGACGAAGCCATCGTCTTTGACGACTCGCCCTCGTCTT
CACGCCCTCGCTCTCTCGACACGGCCGCCTACACTGGTGACATTGATGCCGCCCACTTCCTCGCCCACATTCTCT
CCTTTCTCGAAGCTCCGCCCTTTATGCGCAAGGCTCTTTTCCCCCTACACCCCAATCTGCGCCTCACCGCCCTTC
TTCCTAGTCTCGACATGCCCCATCACCCGCATCCCAAGGAATCTCTCGTCTATCGCGAAGGCGTCACCCTCGACC
GCCCAACCTCGTCGGCAAAGGGCTCCCTCGTTGAGATTGGCGCAGACAGCCCCGTCGAGATTGCAGAGTCGTTGC
CGCCAAAGACGCGGCTTACCCTACGCCTCGATGGCGACGGCGCCCCAGAGTGTGTTGATCCTACTGCGCCCCGTG
TCCACGGCGGCTATTACTGGGGGTACTCGGTTCGCAAGGCTCCCTCGCTTTCCGCAGTCTTTACCGAGTCGCCGT
TTGAAGAGGGCTACGACGTTAGCATCGGCACCTCGGAGCGAGGCATTGCGGTCTCTCAGGCCTTCCCCCAGTCGG
CGCGTCCACTCGACTTTGAGCATTTGCTCATTGTCTTTGGCGGCCCGCGCGGTCTCGAGTTTGCTTCAATGAATG
ATGAGGAGCTGGTTGGTAGAGATGTTCAGGGCCCAAGGACGCGGGACCTGTTTGACCATTGGGTCAATGTGCTGC
CCAACCAAGGAAGCAGAACGATTAGAACCGAGGAGGCGCTCTTGATTGCGCTTACTGCTCTGCGGGGACTTTGGG
ATGCGTCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail