Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6580
Gene name
LocationContig_690:2385..2910
Strand+
Gene length (bp)525
Transcript length (bp)525
Coding sequence length (bp)525
Protein length (aa) 175

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02627 CMD Carboxymuconolactone decarboxylase family 1.9E-09 36 96

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0051920 peroxiredoxin activity Yes
GO:0016209 antioxidant activity No
GO:0003674 molecular_function No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0016491 oxidoreductase activity No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup11765
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6580 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6580
MPRIPLKDIANCSEVEAKVYHKFPANLVRGLLRTTPDIANGYLELGSALAKSPLPPKLREMAILRVGVLSYSRYE
WMQHIGIAKSVHVSEDEIAAVKSGSYTGLSNDEVVLLNFVDELVAKPRVTDNFDKALAALGEQGLATVTLTVGHY
MMTARFLETLAIDLDENATSWDNE*
Coding >OphauG2|6580
ATGCCTCGGATTCCTCTCAAAGACATAGCCAACTGCAGCGAAGTCGAGGCAAAGGTCTACCATAAATTCCCAGCC
AATCTCGTTCGCGGCCTGTTACGAACAACACCAGACATTGCCAACGGCTATCTTGAACTGGGAAGTGCTTTGGCA
AAGTCGCCGCTGCCCCCCAAACTTCGCGAAATGGCCATTTTGCGCGTCGGCGTCCTCAGCTACAGTAGATATGAA
TGGATGCAGCATATCGGCATTGCCAAATCGGTCCATGTCAGTGAAGACGAGATAGCTGCCGTCAAGTCGGGATCG
TATACAGGGCTGAGCAATGATGAGGTTGTACTGCTGAATTTTGTCGACGAGCTTGTTGCAAAGCCTCGGGTCACG
GATAATTTTGATAAAGCTCTAGCCGCTCTCGGAGAGCAGGGTTTGGCTACAGTGACTCTAACAGTCGGCCATTAC
ATGATGACTGCCCGTTTTCTCGAAACACTTGCCATAGACCTGGATGAGAATGCTACAAGCTGGGACAATGAATGA
Transcript >OphauG2|6580
ATGCCTCGGATTCCTCTCAAAGACATAGCCAACTGCAGCGAAGTCGAGGCAAAGGTCTACCATAAATTCCCAGCC
AATCTCGTTCGCGGCCTGTTACGAACAACACCAGACATTGCCAACGGCTATCTTGAACTGGGAAGTGCTTTGGCA
AAGTCGCCGCTGCCCCCCAAACTTCGCGAAATGGCCATTTTGCGCGTCGGCGTCCTCAGCTACAGTAGATATGAA
TGGATGCAGCATATCGGCATTGCCAAATCGGTCCATGTCAGTGAAGACGAGATAGCTGCCGTCAAGTCGGGATCG
TATACAGGGCTGAGCAATGATGAGGTTGTACTGCTGAATTTTGTCGACGAGCTTGTTGCAAAGCCTCGGGTCACG
GATAATTTTGATAAAGCTCTAGCCGCTCTCGGAGAGCAGGGTTTGGCTACAGTGACTCTAACAGTCGGCCATTAC
ATGATGACTGCCCGTTTTCTCGAAACACTTGCCATAGACCTGGATGAGAATGCTACAAGCTGGGACAATGAATGA
Gene >OphauG2|6580
ATGCCTCGGATTCCTCTCAAAGACATAGCCAACTGCAGCGAAGTCGAGGCAAAGGTCTACCATAAATTCCCAGCC
AATCTCGTTCGCGGCCTGTTACGAACAACACCAGACATTGCCAACGGCTATCTTGAACTGGGAAGTGCTTTGGCA
AAGTCGCCGCTGCCCCCCAAACTTCGCGAAATGGCCATTTTGCGCGTCGGCGTCCTCAGCTACAGTAGATATGAA
TGGATGCAGCATATCGGCATTGCCAAATCGGTCCATGTCAGTGAAGACGAGATAGCTGCCGTCAAGTCGGGATCG
TATACAGGGCTGAGCAATGATGAGGTTGTACTGCTGAATTTTGTCGACGAGCTTGTTGCAAAGCCTCGGGTCACG
GATAATTTTGATAAAGCTCTAGCCGCTCTCGGAGAGCAGGGTTTGGCTACAGTGACTCTAACAGTCGGCCATTAC
ATGATGACTGCCCGTTTTCTCGAAACACTTGCCATAGACCTGGATGAGAATGCTACAAGCTGGGACAATGAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail