Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6579
Gene name
LocationContig_690:916..1666
Strand-
Gene length (bp)750
Transcript length (bp)750
Coding sequence length (bp)750
Protein length (aa) 250

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00753 Lactamase_B Metallo-beta-lactamase superfamily 9.0E-28 13 222
PF12706 Lactamase_B_2 Beta-lactamase superfamily domain 8.9E-07 48 174

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O34409|YFLN_BACSU Probable metallo-hydrolase YflN OS=Bacillus subtilis (strain 168) GN=yflN PE=2 SV=1 3 226 2.0E-11
sp|O34910|YOBT_BACSU Uncharacterized protein YobT OS=Bacillus subtilis (strain 168) GN=yobT PE=3 SV=1 8 240 4.0E-11
sp|P37502|YYBB_BACSU Probable metallo-hydrolase YybB OS=Bacillus subtilis (strain 168) GN=yybB PE=3 SV=1 16 179 3.0E-09
sp|P52700|BLA1_STEMA Metallo-beta-lactamase L1 OS=Stenotrophomonas maltophilia PE=1 SV=1 3 109 2.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6579
MTEVAPNVFCISCTDVNAVVLRQGSDLTLIDGGWPGDVDAIEKALESIGHTPQDIRAILLTHAHIDHLGAVQAFH
DRFKIPVYADSVEIRHAAREYIEQASEGDVLKGPMPQTTDWYQRVLKVGADKDITISDVQPVAPGPMDVPGRPVA
IATHGHTSGHSAFYVAEARAIITGDCLVTDHAVSTIKGPQPCPWFFNHSIPDALSALKELKSVDADVIVPGHGQP
LKMPISQAVDIALKAAEESGFSKH*
Coding >OphauG2|6579
ATGACCGAAGTGGCGCCCAACGTCTTCTGCATCAGCTGCACAGATGTAAATGCCGTGGTGCTTCGTCAAGGCTCT
GACCTGACTCTTATAGACGGCGGATGGCCCGGCGACGTTGATGCCATTGAAAAGGCGCTTGAATCCATTGGCCAC
ACGCCACAAGACATTCGGGCCATCTTGTTGACTCACGCACACATTGACCATCTGGGAGCGGTCCAGGCTTTCCAT
GACCGGTTCAAAATCCCCGTCTACGCGGACTCCGTCGAGATCCGCCATGCCGCCCGCGAATACATCGAGCAGGCC
TCCGAGGGCGACGTTTTGAAAGGCCCCATGCCGCAGACAACGGATTGGTACCAGCGGGTGCTCAAGGTGGGCGCC
GACAAGGACATCACCATCTCCGATGTCCAGCCCGTGGCCCCGGGGCCAATGGACGTCCCGGGGCGTCCAGTAGCC
ATTGCCACGCATGGCCACACCTCTGGCCACTCGGCCTTTTACGTTGCGGAAGCTCGCGCCATCATCACCGGCGAC
TGCTTGGTGACCGATCATGCCGTTTCCACAATCAAGGGCCCTCAGCCGTGTCCCTGGTTTTTCAACCACTCGATC
CCAGACGCGCTGTCGGCTCTCAAGGAGTTGAAATCCGTTGATGCAGATGTCATCGTCCCGGGCCATGGCCAGCCC
CTGAAAATGCCCATCAGCCAGGCGGTTGATATTGCTCTCAAGGCAGCTGAAGAAAGTGGTTTCAGCAAGCACTAG
Transcript >OphauG2|6579
ATGACCGAAGTGGCGCCCAACGTCTTCTGCATCAGCTGCACAGATGTAAATGCCGTGGTGCTTCGTCAAGGCTCT
GACCTGACTCTTATAGACGGCGGATGGCCCGGCGACGTTGATGCCATTGAAAAGGCGCTTGAATCCATTGGCCAC
ACGCCACAAGACATTCGGGCCATCTTGTTGACTCACGCACACATTGACCATCTGGGAGCGGTCCAGGCTTTCCAT
GACCGGTTCAAAATCCCCGTCTACGCGGACTCCGTCGAGATCCGCCATGCCGCCCGCGAATACATCGAGCAGGCC
TCCGAGGGCGACGTTTTGAAAGGCCCCATGCCGCAGACAACGGATTGGTACCAGCGGGTGCTCAAGGTGGGCGCC
GACAAGGACATCACCATCTCCGATGTCCAGCCCGTGGCCCCGGGGCCAATGGACGTCCCGGGGCGTCCAGTAGCC
ATTGCCACGCATGGCCACACCTCTGGCCACTCGGCCTTTTACGTTGCGGAAGCTCGCGCCATCATCACCGGCGAC
TGCTTGGTGACCGATCATGCCGTTTCCACAATCAAGGGCCCTCAGCCGTGTCCCTGGTTTTTCAACCACTCGATC
CCAGACGCGCTGTCGGCTCTCAAGGAGTTGAAATCCGTTGATGCAGATGTCATCGTCCCGGGCCATGGCCAGCCC
CTGAAAATGCCCATCAGCCAGGCGGTTGATATTGCTCTCAAGGCAGCTGAAGAAAGTGGTTTCAGCAAGCACTAG
Gene >OphauG2|6579
ATGACCGAAGTGGCGCCCAACGTCTTCTGCATCAGCTGCACAGATGTAAATGCCGTGGTGCTTCGTCAAGGCTCT
GACCTGACTCTTATAGACGGCGGATGGCCCGGCGACGTTGATGCCATTGAAAAGGCGCTTGAATCCATTGGCCAC
ACGCCACAAGACATTCGGGCCATCTTGTTGACTCACGCACACATTGACCATCTGGGAGCGGTCCAGGCTTTCCAT
GACCGGTTCAAAATCCCCGTCTACGCGGACTCCGTCGAGATCCGCCATGCCGCCCGCGAATACATCGAGCAGGCC
TCCGAGGGCGACGTTTTGAAAGGCCCCATGCCGCAGACAACGGATTGGTACCAGCGGGTGCTCAAGGTGGGCGCC
GACAAGGACATCACCATCTCCGATGTCCAGCCCGTGGCCCCGGGGCCAATGGACGTCCCGGGGCGTCCAGTAGCC
ATTGCCACGCATGGCCACACCTCTGGCCACTCGGCCTTTTACGTTGCGGAAGCTCGCGCCATCATCACCGGCGAC
TGCTTGGTGACCGATCATGCCGTTTCCACAATCAAGGGCCCTCAGCCGTGTCCCTGGTTTTTCAACCACTCGATC
CCAGACGCGCTGTCGGCTCTCAAGGAGTTGAAATCCGTTGATGCAGATGTCATCGTCCCGGGCCATGGCCAGCCC
CTGAAAATGCCCATCAGCCAGGCGGTTGATATTGCTCTCAAGGCAGCTGAAGAAAGTGGTTTCAGCAAGCACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail