Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6568
Gene name
LocationContig_69:14298..15352
Strand-
Gene length (bp)1054
Transcript length (bp)927
Coding sequence length (bp)927
Protein length (aa) 309

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01048 PNP_UDP_1 Phosphorylase superfamily 1.2E-36 15 256

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C7YLQ3|MTAP_NECH7 S-methyl-5'-thioadenosine phosphorylase OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_67177 PE=3 SV=1 3 307 0.0E+00
sp|Q7RZA5|MTAP_NEUCR S-methyl-5'-thioadenosine phosphorylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU03963 PE=3 SV=1 4 307 3.0E-174
sp|Q0U796|MTAP_PHANO S-methyl-5'-thioadenosine phosphorylase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_12368 PE=3 SV=2 3 307 1.0E-145
sp|Q4WMU1|MTAP_ASPFU S-methyl-5'-thioadenosine phosphorylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_6G08720 PE=3 SV=1 5 306 2.0E-145
sp|A7EAA1|MTAP_SCLS1 S-methyl-5'-thioadenosine phosphorylase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_02233 PE=3 SV=1 1 260 1.0E-141
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C7YLQ3|MTAP_NECH7 S-methyl-5'-thioadenosine phosphorylase OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_67177 PE=3 SV=1 3 307 0.0E+00
sp|Q7RZA5|MTAP_NEUCR S-methyl-5'-thioadenosine phosphorylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU03963 PE=3 SV=1 4 307 3.0E-174
sp|Q0U796|MTAP_PHANO S-methyl-5'-thioadenosine phosphorylase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_12368 PE=3 SV=2 3 307 1.0E-145
sp|Q4WMU1|MTAP_ASPFU S-methyl-5'-thioadenosine phosphorylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_6G08720 PE=3 SV=1 5 306 2.0E-145
sp|A7EAA1|MTAP_SCLS1 S-methyl-5'-thioadenosine phosphorylase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_02233 PE=3 SV=1 1 260 1.0E-141
sp|C8VP37|MTAP_EMENI S-methyl-5'-thioadenosine phosphorylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10230 PE=3 SV=1 3 307 8.0E-141
sp|C0NRX4|MTAP_AJECG S-methyl-5'-thioadenosine phosphorylase OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_05904 PE=3 SV=1 3 306 2.0E-139
sp|D5GFR0|MTAP_TUBMM S-methyl-5'-thioadenosine phosphorylase OS=Tuber melanosporum (strain Mel28) GN=GSTUM_00007013001 PE=3 SV=2 5 306 2.0E-123
sp|Q59ST1|MTAP_CANAL S-methyl-5'-thioadenosine phosphorylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MEU1 PE=3 SV=1 3 307 1.0E-100
sp|C4YQD9|MTAP_CANAW S-methyl-5'-thioadenosine phosphorylase OS=Candida albicans (strain WO-1) GN=MEU1 PE=3 SV=1 3 307 2.0E-99
sp|Q6CES3|MTAP_YARLI S-methyl-5'-thioadenosine phosphorylase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MEU1 PE=3 SV=1 5 306 3.0E-99
sp|Q09816|MTAP_SCHPO S-methyl-5'-thioadenosine phosphorylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16C9.02c PE=3 SV=1 11 308 8.0E-97
sp|Q72LZ4|MTAP_LEPIC S-methyl-5'-thioadenosine phosphorylase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=mtnP PE=3 SV=1 13 306 2.0E-89
sp|Q07938|MTAP_YEAST S-methyl-5'-thioadenosine phosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEU1 PE=1 SV=1 3 306 5.0E-88
sp|Q8CXR2|MTAP_LEPIN S-methyl-5'-thioadenosine phosphorylase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=mtnP PE=3 SV=1 13 306 1.0E-87
sp|E3K7C3|MTAP1_PUCGT S-methyl-5'-thioadenosine phosphorylase 1 OS=Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL) GN=PGTG_06409 PE=3 SV=1 15 305 2.0E-86
sp|Q5KPU2|MTAP_CRYNJ S-methyl-5'-thioadenosine phosphorylase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNA01530 PE=3 SV=1 10 305 2.0E-84
sp|Q4PH43|MTAP_USTMA S-methyl-5'-thioadenosine phosphorylase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_10466 PE=3 SV=3 12 305 5.0E-84
sp|A8P7Y3|MTAP_COPC7 S-methyl-5'-thioadenosine phosphorylase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_06667 PE=3 SV=1 10 259 3.0E-83
sp|P0DJF9|MTAP_SYNYG S-methyl-5'-thioadenosine phosphorylase OS=Synechocystis sp. (strain PCC 6803 / GT-S) GN=mtnP PE=3 SV=1 15 308 5.0E-78
sp|P0DJF8|MTAP_SYNY3 S-methyl-5'-thioadenosine phosphorylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=mtnP PE=3 SV=1 15 308 5.0E-78
sp|Q8DJE4|MTAP_THEEB S-methyl-5'-thioadenosine phosphorylase OS=Thermosynechococcus elongatus (strain BP-1) GN=mtnP PE=3 SV=1 15 252 3.0E-76
sp|E3K7C1|MTAP2_PUCGT S-methyl-5'-thioadenosine phosphorylase 2 OS=Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL) GN=PGTG_06407 PE=3 SV=1 15 305 9.0E-76
sp|Q7VDN6|MTAP_PROMA S-methyl-5'-thioadenosine phosphorylase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=mtnP PE=3 SV=1 4 262 3.0E-74
sp|Q74E52|MTAP_GEOSL S-methyl-5'-thioadenosine phosphorylase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=mtnP PE=3 SV=1 15 273 6.0E-69
sp|A9WAL0|MTAP_CHLAA S-methyl-5'-thioadenosine phosphorylase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=mtnP PE=3 SV=1 15 261 4.0E-68
sp|Q1INC3|MTAP_KORVE S-methyl-5'-thioadenosine phosphorylase OS=Koribacter versatilis (strain Ellin345) GN=mtnP PE=3 SV=1 14 248 5.0E-68
sp|A1RXU2|MTAP_THEPD S-methyl-5'-thioadenosine phosphorylase OS=Thermofilum pendens (strain Hrk 5) GN=mtnP PE=3 SV=1 13 259 4.0E-65
sp|Q7NHW1|MTAP_GLOVI S-methyl-5'-thioadenosine phosphorylase OS=Gloeobacter violaceus (strain PCC 7421) GN=mtnP PE=3 SV=1 14 297 6.0E-63
sp|Q9V2F1|MTAP_PYRAB S-methyl-5'-thioadenosine phosphorylase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=mntP PE=3 SV=1 15 259 1.0E-61
sp|Q5JEQ6|MTAP_THEKO S-methyl-5'-thioadenosine phosphorylase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=mtnP PE=3 SV=1 15 265 1.0E-61
sp|Q8U4Q8|MTAP_PYRFU S-methyl-5'-thioadenosine phosphorylase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=mtnP PE=1 SV=1 15 259 2.0E-60
sp|Q97W94|MTAP_SULSO S-methyl-5'-thioadenosine phosphorylase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=mtnP PE=1 SV=1 10 259 5.0E-60
sp|O57865|MTAP_PYRHO S-methyl-5'-thioadenosine phosphorylase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=mtnP PE=3 SV=2 15 259 1.0E-59
sp|Q3J5E8|MTAP_RHOS4 S-methyl-5'-thioadenosine phosphorylase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=mtnP PE=3 SV=1 15 299 4.0E-59
sp|F6X2V8|MTAP_CIOIN S-methyl-5'-thioadenosine phosphorylase OS=Ciona intestinalis PE=3 SV=1 15 261 5.0E-59
sp|A2BIU4|MTAP_HYPBU S-methyl-5'-thioadenosine phosphorylase OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=mtnP PE=3 SV=1 4 259 1.0E-57
sp|Q2RXH9|MTAP_RHORT S-methyl-5'-thioadenosine phosphorylase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=mtnP PE=3 SV=1 5 259 1.0E-57
sp|Q9CQ65|MTAP_MOUSE S-methyl-5'-thioadenosine phosphorylase OS=Mus musculus GN=Mtap PE=1 SV=1 13 268 1.0E-57
sp|F6RQL9|MTAP_MACMU S-methyl-5'-thioadenosine phosphorylase OS=Macaca mulatta GN=MTAP PE=3 SV=1 8 268 2.0E-57
sp|Q13126|MTAP_HUMAN S-methyl-5'-thioadenosine phosphorylase OS=Homo sapiens GN=MTAP PE=1 SV=2 8 268 2.0E-57
sp|Q9YAQ8|MTAP_AERPE S-methyl-5'-thioadenosine phosphorylase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=mtnP PE=1 SV=1 14 260 5.0E-57
sp|Q7ZV22|MTAP_DANRE S-methyl-5'-thioadenosine phosphorylase OS=Danio rerio GN=mtap PE=2 SV=2 8 283 2.0E-55
sp|F6V515|MTAP_XENTR S-methyl-5'-thioadenosine phosphorylase OS=Xenopus tropicalis GN=mtap PE=3 SV=1 13 272 5.0E-55
sp|Q8ZTB2|MTAP_PYRAE S-methyl-5'-thioadenosine phosphorylase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=mtnP PE=3 SV=1 9 259 3.0E-52
sp|Q89VT5|MTAP_BRADU S-methyl-5'-thioadenosine phosphorylase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=mtnP PE=3 SV=1 15 299 2.0E-51
sp|A0QR54|MTAP_MYCS2 S-methyl-5'-thioadenosine phosphorylase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=mtnP PE=1 SV=1 15 224 6.0E-51
sp|A7SN31|MTAP_NEMVE S-methyl-5'-thioadenosine phosphorylase OS=Nematostella vectensis GN=v1g214799 PE=3 SV=1 13 274 4.0E-50
sp|Q9V813|MTAP_DROME S-methyl-5'-thioadenosine phosphorylase OS=Drosophila melanogaster GN=Mtap PE=2 SV=1 12 272 5.0E-50
sp|Q9HL98|MTAP_THEAC S-methyl-5'-thioadenosine phosphorylase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=mtnP PE=3 SV=1 14 261 5.0E-50
sp|A9A3N5|MTAP_NITMS S-methyl-5'-thioadenosine phosphorylase OS=Nitrosopumilus maritimus (strain SCM1) GN=mtnP PE=3 SV=1 10 261 1.0E-49
sp|Q3MHF7|MTAP_BOVIN S-methyl-5'-thioadenosine phosphorylase OS=Bos taurus GN=MTAP PE=1 SV=1 13 268 2.0E-49
sp|Q09438|MTAP_CAEEL S-methyl-5'-thioadenosine phosphorylase OS=Caenorhabditis elegans GN=B0228.7 PE=3 SV=2 13 269 5.0E-48
sp|Q291H4|MTAP_DROPS S-methyl-5'-thioadenosine phosphorylase OS=Drosophila pseudoobscura pseudoobscura GN=GA18442 PE=3 SV=1 12 272 6.0E-48
sp|A8XGS6|MTAP_CAEBR S-methyl-5'-thioadenosine phosphorylase OS=Caenorhabditis briggsae GN=CBG12968 PE=3 SV=1 13 272 1.0E-46
sp|O06401|MTAP_MYCTU S-methyl-5'-thioadenosine phosphorylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mtnP PE=1 SV=1 15 260 1.0E-46
sp|Q7Q9N9|MTAP_ANOGA S-methyl-5'-thioadenosine phosphorylase OS=Anopheles gambiae GN=AGAP005129 PE=3 SV=4 13 268 5.0E-46
sp|A0RVQ7|MTAP_CENSY S-methyl-5'-thioadenosine phosphorylase OS=Cenarchaeum symbiosum (strain A) GN=mtnP PE=3 SV=1 35 261 6.0E-46
sp|Q5JJB8|PNPH_THEKO Probable 6-oxopurine nucleoside phosphorylase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK1482 PE=3 SV=1 14 261 7.0E-46
sp|Q16MW6|MTAP_AEDAE S-methyl-5'-thioadenosine phosphorylase OS=Aedes aegypti GN=AAEL012172 PE=3 SV=1 56 268 2.0E-45
sp|Q8U2I1|PNPH_PYRFU Probable 6-oxopurine nucleoside phosphorylase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0853 PE=1 SV=1 14 261 6.0E-44
sp|E3XFR6|MTAP_ANODA S-methyl-5'-thioadenosine phosphorylase OS=Anopheles darlingi GN=AND_22863 PE=3 SV=1 14 268 2.0E-42
sp|Q9KYV7|PNPH_STRCO Purine nucleoside phosphorylase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3188 PE=3 SV=1 14 265 3.0E-41
sp|B8E181|PNPH_DICTD Probable 6-oxopurine nucleoside phosphorylase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=Dtur_0928 PE=3 SV=1 13 261 2.0E-40
sp|Q2RKL6|PNPH_MOOTA Probable 6-oxopurine nucleoside phosphorylase OS=Moorella thermoacetica (strain ATCC 39073) GN=Moth_0705 PE=3 SV=1 13 252 3.0E-40
sp|B5YKP5|MTIP_THEYD Probable S-methyl-5'-thioinosine phosphorylase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=THEYE_A0977 PE=3 SV=1 13 213 7.0E-39
sp|Q9HZK1|MTIP_PSEAE S-methyl-5'-thioinosine phosphorylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3004 PE=1 SV=1 16 256 3.0E-36
sp|O66839|PNPH_AQUAE Probable 6-oxopurine nucleoside phosphorylase OS=Aquifex aeolicus (strain VF5) GN=aq_568 PE=3 SV=1 15 277 4.0E-36
sp|O27633|MTIP_METTH Probable S-methyl-5'-thioinosine phosphorylase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_1596 PE=3 SV=1 36 265 6.0E-36
sp|Q87ZC3|MTIP_PSESM Probable S-methyl-5'-thioinosine phosphorylase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=PSPTO_3506 PE=3 SV=1 16 257 1.0E-35
sp|Q60367|MTIP_METJA Probable S-methyl-5'-thioinosine phosphorylase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0060 PE=3 SV=1 49 242 2.0E-35
sp|Q297F5|PNPH_DROPS Purine nucleoside phosphorylase OS=Drosophila pseudoobscura pseudoobscura GN=GA16019 PE=3 SV=2 12 271 4.0E-34
sp|Q8PB40|MTIP_XANCP Probable S-methyl-5'-thioinosine phosphorylase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=XCC1285 PE=3 SV=1 13 253 2.0E-31
sp|Q87BR7|MTIP_XYLFT Probable S-methyl-5'-thioinosine phosphorylase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=mtnP PE=3 SV=1 11 261 2.0E-31
sp|Q8IMU4|PNPH_DROME Purine nucleoside phosphorylase OS=Drosophila melanogaster GN=CG31115 PE=3 SV=2 1 271 2.0E-30
sp|Q9PAZ2|MTIP_XYLFA Probable S-methyl-5'-thioinosine phosphorylase OS=Xylella fastidiosa (strain 9a5c) GN=XF_2353 PE=3 SV=1 11 223 2.0E-30
sp|Q8TZB4|MTIP_METKA Probable S-methyl-5'-thioinosine phosphorylase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=MK0021 PE=3 SV=1 14 223 2.0E-27
sp|B1L719|PNPH_KORCO Probable 6-oxopurine nucleoside phosphorylase OS=Korarchaeum cryptofilum (strain OPF8) GN=Kcr_1502 PE=3 SV=1 13 223 6.0E-26
sp|Q8TQX8|MTIP_METAC Probable S-methyl-5'-thioinosine phosphorylase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1409 PE=3 SV=1 15 271 3.0E-18
sp|O28486|PNPH_ARCFU Probable 6-oxopurine nucleoside phosphorylase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1788 PE=3 SV=1 15 262 6.0E-18
sp|P23139|YPE2_RHORU Uncharacterized 25.8 kDa protein in petC 3'region OS=Rhodospirillum rubrum PE=3 SV=1 5 132 5.0E-16
sp|Q9UTG1|PNPH_SCHPO Putative purine nucleoside phosphorylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1805.16c PE=3 SV=1 4 222 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0009116 nucleoside metabolic process Yes
GO:1901135 carbohydrate derivative metabolic process No
GO:0044238 primary metabolic process No
GO:0044281 small molecule metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0046483 heterocycle metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:1901657 glycosyl compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6568
MAADLPSTFDKPVHIAVIGGTGLGHLDGFTPVATLSPTTPWGPPASPIQILAHKDVNVAFLARHGIHHEFAPHEV
PNRANIAALRHIGVRCIIAFSAVGSLQLDIKPMDFVVPDQAIDRTKGIRPFTFFEGGVVGHVSFADPFDAALAQV
VKNCAAHMHGEGVVLHDKGTLVCMEGPQFSTRAESHMYRSWGGSVINMSTLPEAKLAREAEMAYQVIAMATDYDC
WHSFDDVNVEMVVKYMQANGSNAKRLLGAVLDQLSKLEHSDLVMAKRWQGASQGAVKFMTKPEGRSPDAIKRVEY
LFPGFWEP*
Coding >OphauG2|6568
ATGGCTGCGGACCTACCATCTACATTTGACAAGCCCGTCCACATCGCCGTCATAGGTGGCACCGGCCTCGGCCAT
CTCGATGGATTTACTCCGGTTGCTACGCTGAGTCCAACGACGCCGTGGGGACCGCCAGCTTCGCCCATCCAGATC
CTTGCCCACAAGGACGTCAATGTGGCCTTTCTGGCTCGCCATGGCATCCACCACGAGTTTGCGCCGCACGAGGTG
CCCAACCGCGCCAACATTGCCGCTCTGCGTCACATTGGCGTCAGATGCATCATTGCCTTCTCCGCCGTTGGCTCC
CTGCAGCTCGACATCAAGCCCATGGACTTTGTAGTCCCGGACCAGGCCATTGATCGCACAAAGGGCATCCGCCCT
TTTACTTTTTTCGAGGGCGGTGTCGTGGGCCATGTCAGCTTCGCAGACCCCTTTGACGCTGCGCTGGCCCAAGTG
GTCAAAAACTGTGCGGCTCACATGCATGGCGAAGGAGTCGTGCTCCATGATAAAGGGACCCTGGTGTGCATGGAG
GGTCCGCAGTTTTCTACCCGCGCCGAGTCGCACATGTACCGAAGCTGGGGGGGCTCCGTCATCAACATGTCCACG
CTGCCCGAGGCCAAGCTAGCCCGAGAGGCAGAAATGGCCTATCAAGTCATTGCCATGGCCACCGACTACGACTGC
TGGCACTCGTTTGATGATGTTAATGTGGAGATGGTGGTCAAGTACATGCAGGCAAACGGTAGCAATGCCAAGCGC
CTCCTTGGCGCCGTCCTTGATCAGCTGTCCAAACTAGAACACAGCGACCTGGTCATGGCTAAGCGCTGGCAAGGC
GCTAGTCAAGGAGCTGTCAAGTTCATGACCAAGCCCGAGGGCAGAAGCCCGGATGCTATCAAGAGGGTCGAATAT
CTCTTTCCCGGGTTCTGGGAGCCCTAG
Transcript >OphauG2|6568
ATGGCTGCGGACCTACCATCTACATTTGACAAGCCCGTCCACATCGCCGTCATAGGTGGCACCGGCCTCGGCCAT
CTCGATGGATTTACTCCGGTTGCTACGCTGAGTCCAACGACGCCGTGGGGACCGCCAGCTTCGCCCATCCAGATC
CTTGCCCACAAGGACGTCAATGTGGCCTTTCTGGCTCGCCATGGCATCCACCACGAGTTTGCGCCGCACGAGGTG
CCCAACCGCGCCAACATTGCCGCTCTGCGTCACATTGGCGTCAGATGCATCATTGCCTTCTCCGCCGTTGGCTCC
CTGCAGCTCGACATCAAGCCCATGGACTTTGTAGTCCCGGACCAGGCCATTGATCGCACAAAGGGCATCCGCCCT
TTTACTTTTTTCGAGGGCGGTGTCGTGGGCCATGTCAGCTTCGCAGACCCCTTTGACGCTGCGCTGGCCCAAGTG
GTCAAAAACTGTGCGGCTCACATGCATGGCGAAGGAGTCGTGCTCCATGATAAAGGGACCCTGGTGTGCATGGAG
GGTCCGCAGTTTTCTACCCGCGCCGAGTCGCACATGTACCGAAGCTGGGGGGGCTCCGTCATCAACATGTCCACG
CTGCCCGAGGCCAAGCTAGCCCGAGAGGCAGAAATGGCCTATCAAGTCATTGCCATGGCCACCGACTACGACTGC
TGGCACTCGTTTGATGATGTTAATGTGGAGATGGTGGTCAAGTACATGCAGGCAAACGGTAGCAATGCCAAGCGC
CTCCTTGGCGCCGTCCTTGATCAGCTGTCCAAACTAGAACACAGCGACCTGGTCATGGCTAAGCGCTGGCAAGGC
GCTAGTCAAGGAGCTGTCAAGTTCATGACCAAGCCCGAGGGCAGAAGCCCGGATGCTATCAAGAGGGTCGAATAT
CTCTTTCCCGGGTTCTGGGAGCCCTAG
Gene >OphauG2|6568
ATGGCTGCGGACCTACCATCTACATTTGACAGTACGGTACCCTCTGACGGCGCAGTCCTTGGCAAATTTCTGACA
AGCTGCCAGAGCCCGTCCACATCGCCGTCATAGGTGGCACCGGCCTCGGCCATCTCGATGGATTTACTCCGGTTG
CTACGCTGAGTCCAACGACGCCGTGGGGACCGCCAGCTTCGCCCATCCAGATCCTTGCCCACAAGGACGTCAATG
TGGCCTTTCTGGCTCGCCATGGCATCCACCACGAGTTTGCGCCGCACGAGGTGCCCAACCGCGCCAACATTGCCG
CTCTGCGTCACATTGGCGTCAGATGCATCATTGCCTTCTCCGCCGTTGGCTCCCTGCAGCTCGACATCAAGCCCA
TGGACTTTGTAGTCCCGGACCAGGCCATTGATCGCACAAAGGGCATCCGCCCTTTTACTTTTTTCGAGGGCGGTG
TCGTGGGCCATGTCAGCTTCGCAGACCCCTTTGACGCTGCGCTGGCCCAAGTGGTCAAAAACTGTGCGGCTCACA
TGCATGGCGAAGGAGTCGTGCTCCATGATAAAGGGACCCTGGTGTGCATGGGTCCGTCGCCCCTCAGTGTAGACG
GCTCTTTTTCGCCATTGCGGTGTGGCTAACAAGGCTGTCTTGCGTCTTAGAGGGTCCGCAGTTTTCTACCCGCGC
CGAGTCGCACATGTACCGAAGCTGGGGGGGCTCCGTCATCAACATGTCCACGCTGCCCGAGGCCAAGCTAGCCCG
AGAGGCAGAAATGGCCTATCAAGTCATTGCCATGGCCACCGACTACGACTGCTGGCACTCGTTTGATGATGTTAA
TGTGGAGATGGTGGTCAAGTACATGCAGGCAAACGGTAGCAATGCCAAGCGCCTCCTTGGCGCCGTCCTTGATCA
GCTGTCCAAACTAGAACACAGCGACCTGGTCATGGCTAAGCGCTGGCAAGGCGCTAGTCAAGGAGCTGTCAAGTT
CATGACCAAGCCCGAGGGCAGAAGCCCGGATGCTATCAAGAGGGTCGAATATCTCTTTCCCGGGTTCTGGGAGCC
CTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail