Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6567
Gene name
LocationContig_69:7550..8843
Strand-
Gene length (bp)1293
Transcript length (bp)1293
Coding sequence length (bp)1293
Protein length (aa) 431

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10017 Methyltransf_33 Histidine-specific methyltransferase, SAM-dependent 6.6E-80 112 410

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RX33|EGT1_NEUCR Ergothioneine biosynthesis protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=egt-1 PE=1 SV=3 97 412 3.0E-33
sp|B6D5I7|FGAMT_ASPFM 4-dimethylallyltryptophan N-methyltransferase OS=Neosartorya fumigata GN=fgaMT PE=1 SV=1 112 412 2.0E-19
sp|Q4WZ60|FGAMT_ASPFU 4-dimethylallyltryptophan N-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fgaMT PE=3 SV=1 112 412 3.0E-19
sp|O94632|EGT1_SCHPO Ergothioneine biosynthesis protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=egt1 PE=1 SV=4 116 417 2.0E-17
sp|P9WN47|EGTD_MYCTU Histidine N-alpha-methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=egtD PE=1 SV=1 90 334 7.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RX33|EGT1_NEUCR Ergothioneine biosynthesis protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=egt-1 PE=1 SV=3 97 412 3.0E-33
sp|B6D5I7|FGAMT_ASPFM 4-dimethylallyltryptophan N-methyltransferase OS=Neosartorya fumigata GN=fgaMT PE=1 SV=1 112 412 2.0E-19
sp|Q4WZ60|FGAMT_ASPFU 4-dimethylallyltryptophan N-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fgaMT PE=3 SV=1 112 412 3.0E-19
sp|O94632|EGT1_SCHPO Ergothioneine biosynthesis protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=egt1 PE=1 SV=4 116 417 2.0E-17
sp|P9WN47|EGTD_MYCTU Histidine N-alpha-methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=egtD PE=1 SV=1 90 334 7.0E-16
sp|P9WN46|EGTD_MYCTO Histidine N-alpha-methyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=egtD PE=3 SV=1 90 334 7.0E-16
sp|A0R5M8|EGTD_MYCS2 Histidine N-alpha-methyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=egtD PE=1 SV=1 115 334 2.0E-14
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6567
MPVDAIIIDPKEHLHRRLGHNHKPARKPGIEQAFAAHARTNHQPPAPLESARWPIRCLFQPHLPLSMAGPATATL
APRHGAVVDIGGSAMNDDVGHKLACVIQTPCSSTATEKPTLPDECLYDDIGLPIWNEIIQTPEFYQTHDEIALFD
LNGPEIVANTKPGTTLIDLGAGDTGKVQHLLEAFQKADKPVTYLALDISKASLDLNIAFLEAKHPVGKSSVTCAG
LWGDFHKGKEYAQRIKGPRLFLSLGSVLCNDEWCKALHHLKYWAEIIRPEDQLLVGMDGHLLPKDDVKLWAAYHS
RDDLYRQFFLNGFDHANRLLGEKVFREADWDFKANLEDKPTTRHRFFFVAKRDIRIKTFGRIIKKGEEWDWFDSH
KYGESDVNIMCSKAGLRVVKTYQAPDSEFRQYLIKTRDPSGLSEDADSAVSGISA*
Coding >OphauG2|6567
ATGCCTGTCGACGCAATCATCATTGACCCCAAAGAACATCTGCATCGACGTCTTGGCCACAACCACAAGCCAGCA
CGGAAACCCGGTATAGAGCAGGCATTTGCAGCCCATGCACGGACTAACCATCAGCCTCCTGCCCCCCTCGAATCA
GCTCGCTGGCCTATCCGCTGTCTTTTCCAGCCCCATTTGCCCTTGTCCATGGCTGGTCCCGCCACAGCAACTCTT
GCGCCTCGCCATGGCGCCGTCGTCGACATTGGCGGCAGCGCAATGAACGACGACGTCGGCCACAAGCTCGCCTGC
GTCATCCAGACGCCTTGCTCCTCCACAGCCACGGAGAAGCCAACCTTGCCTGATGAATGCCTCTACGACGACATA
GGCCTTCCAATCTGGAACGAAATCATCCAGACGCCCGAGTTCTACCAGACTCATGACGAGATTGCCCTCTTCGAC
CTCAACGGCCCCGAGATTGTCGCAAACACAAAGCCTGGCACCACCCTGATTGACCTGGGTGCCGGCGACACCGGC
AAGGTCCAGCACCTGCTCGAGGCCTTTCAAAAAGCAGACAAGCCTGTAACATATCTGGCTCTCGACATCTCAAAG
GCCTCGCTTGACCTCAACATTGCCTTTCTCGAAGCCAAGCACCCTGTGGGCAAGTCGAGCGTTACTTGCGCCGGT
CTTTGGGGCGACTTTCACAAGGGCAAAGAATACGCCCAGCGCATCAAGGGACCGCGTCTCTTTCTTTCCCTCGGC
TCCGTTCTCTGCAACGACGAGTGGTGCAAAGCTCTACATCATCTCAAGTACTGGGCCGAAATCATCCGCCCCGAG
GATCAACTGCTGGTCGGCATGGACGGGCATTTGCTGCCCAAGGACGACGTCAAGCTATGGGCTGCGTACCATTCT
CGAGACGATCTCTACCGCCAGTTTTTCCTAAATGGCTTCGATCATGCCAATAGACTATTGGGAGAAAAGGTCTTT
CGCGAGGCTGACTGGGATTTCAAAGCCAACCTCGAGGACAAGCCTACTACCCGCCACCGCTTCTTCTTTGTTGCA
AAAAGAGACATCCGCATCAAAACCTTTGGCCGAATCATCAAGAAGGGCGAGGAGTGGGATTGGTTTGACTCTCAT
AAATATGGCGAAAGCGATGTTAATATCATGTGCAGCAAGGCCGGTTTGCGAGTCGTCAAAACCTACCAGGCCCCA
GACTCTGAGTTTCGTCAGTACCTCATCAAGACAAGAGACCCAAGCGGTCTGTCAGAGGATGCCGATAGCGCCGTA
TCGGGCATATCTGCCTAG
Transcript >OphauG2|6567
ATGCCTGTCGACGCAATCATCATTGACCCCAAAGAACATCTGCATCGACGTCTTGGCCACAACCACAAGCCAGCA
CGGAAACCCGGTATAGAGCAGGCATTTGCAGCCCATGCACGGACTAACCATCAGCCTCCTGCCCCCCTCGAATCA
GCTCGCTGGCCTATCCGCTGTCTTTTCCAGCCCCATTTGCCCTTGTCCATGGCTGGTCCCGCCACAGCAACTCTT
GCGCCTCGCCATGGCGCCGTCGTCGACATTGGCGGCAGCGCAATGAACGACGACGTCGGCCACAAGCTCGCCTGC
GTCATCCAGACGCCTTGCTCCTCCACAGCCACGGAGAAGCCAACCTTGCCTGATGAATGCCTCTACGACGACATA
GGCCTTCCAATCTGGAACGAAATCATCCAGACGCCCGAGTTCTACCAGACTCATGACGAGATTGCCCTCTTCGAC
CTCAACGGCCCCGAGATTGTCGCAAACACAAAGCCTGGCACCACCCTGATTGACCTGGGTGCCGGCGACACCGGC
AAGGTCCAGCACCTGCTCGAGGCCTTTCAAAAAGCAGACAAGCCTGTAACATATCTGGCTCTCGACATCTCAAAG
GCCTCGCTTGACCTCAACATTGCCTTTCTCGAAGCCAAGCACCCTGTGGGCAAGTCGAGCGTTACTTGCGCCGGT
CTTTGGGGCGACTTTCACAAGGGCAAAGAATACGCCCAGCGCATCAAGGGACCGCGTCTCTTTCTTTCCCTCGGC
TCCGTTCTCTGCAACGACGAGTGGTGCAAAGCTCTACATCATCTCAAGTACTGGGCCGAAATCATCCGCCCCGAG
GATCAACTGCTGGTCGGCATGGACGGGCATTTGCTGCCCAAGGACGACGTCAAGCTATGGGCTGCGTACCATTCT
CGAGACGATCTCTACCGCCAGTTTTTCCTAAATGGCTTCGATCATGCCAATAGACTATTGGGAGAAAAGGTCTTT
CGCGAGGCTGACTGGGATTTCAAAGCCAACCTCGAGGACAAGCCTACTACCCGCCACCGCTTCTTCTTTGTTGCA
AAAAGAGACATCCGCATCAAAACCTTTGGCCGAATCATCAAGAAGGGCGAGGAGTGGGATTGGTTTGACTCTCAT
AAATATGGCGAAAGCGATGTTAATATCATGTGCAGCAAGGCCGGTTTGCGAGTCGTCAAAACCTACCAGGCCCCA
GACTCTGAGTTTCGTCAGTACCTCATCAAGACAAGAGACCCAAGCGGTCTGTCAGAGGATGCCGATAGCGCCGTA
TCGGGCATATCTGCCTAG
Gene >OphauG2|6567
ATGCCTGTCGACGCAATCATCATTGACCCCAAAGAACATCTGCATCGACGTCTTGGCCACAACCACAAGCCAGCA
CGGAAACCCGGTATAGAGCAGGCATTTGCAGCCCATGCACGGACTAACCATCAGCCTCCTGCCCCCCTCGAATCA
GCTCGCTGGCCTATCCGCTGTCTTTTCCAGCCCCATTTGCCCTTGTCCATGGCTGGTCCCGCCACAGCAACTCTT
GCGCCTCGCCATGGCGCCGTCGTCGACATTGGCGGCAGCGCAATGAACGACGACGTCGGCCACAAGCTCGCCTGC
GTCATCCAGACGCCTTGCTCCTCCACAGCCACGGAGAAGCCAACCTTGCCTGATGAATGCCTCTACGACGACATA
GGCCTTCCAATCTGGAACGAAATCATCCAGACGCCCGAGTTCTACCAGACTCATGACGAGATTGCCCTCTTCGAC
CTCAACGGCCCCGAGATTGTCGCAAACACAAAGCCTGGCACCACCCTGATTGACCTGGGTGCCGGCGACACCGGC
AAGGTCCAGCACCTGCTCGAGGCCTTTCAAAAAGCAGACAAGCCTGTAACATATCTGGCTCTCGACATCTCAAAG
GCCTCGCTTGACCTCAACATTGCCTTTCTCGAAGCCAAGCACCCTGTGGGCAAGTCGAGCGTTACTTGCGCCGGT
CTTTGGGGCGACTTTCACAAGGGCAAAGAATACGCCCAGCGCATCAAGGGACCGCGTCTCTTTCTTTCCCTCGGC
TCCGTTCTCTGCAACGACGAGTGGTGCAAAGCTCTACATCATCTCAAGTACTGGGCCGAAATCATCCGCCCCGAG
GATCAACTGCTGGTCGGCATGGACGGGCATTTGCTGCCCAAGGACGACGTCAAGCTATGGGCTGCGTACCATTCT
CGAGACGATCTCTACCGCCAGTTTTTCCTAAATGGCTTCGATCATGCCAATAGACTATTGGGAGAAAAGGTCTTT
CGCGAGGCTGACTGGGATTTCAAAGCCAACCTCGAGGACAAGCCTACTACCCGCCACCGCTTCTTCTTTGTTGCA
AAAAGAGACATCCGCATCAAAACCTTTGGCCGAATCATCAAGAAGGGCGAGGAGTGGGATTGGTTTGACTCTCAT
AAATATGGCGAAAGCGATGTTAATATCATGTGCAGCAAGGCCGGTTTGCGAGTCGTCAAAACCTACCAGGCCCCA
GACTCTGAGTTTCGTCAGTACCTCATCAAGACAAGAGACCCAAGCGGTCTGTCAGAGGATGCCGATAGCGCCGTA
TCGGGCATATCTGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail