Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6560
Gene name
LocationContig_689:5156..6509
Strand-
Gene length (bp)1353
Transcript length (bp)1353
Coding sequence length (bp)1353
Protein length (aa) 451

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01375 Enterotoxin_a Heat-labile enterotoxin alpha chain 8.6E-29 33 213

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P01555|CHTA_VIBCH Cholera enterotoxin subunit A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ctxA PE=1 SV=1 33 209 2.0E-16
sp|P43530|ELAH_ECOH1 Heat-labile enterotoxin A chain OS=Escherichia coli O78:H11 (strain H10407 / ETEC) GN=eltA PE=3 SV=1 24 228 1.0E-15
sp|P06717|ELAP_ECOLX Heat-labile enterotoxin A chain OS=Escherichia coli GN=eltA PE=1 SV=1 24 228 2.0E-15
sp|P13810|E2AA_ECOLX Heat-labile enterotoxin IIA, A chain OS=Escherichia coli PE=3 SV=1 34 215 1.0E-14
sp|P43528|E2BA_ECOLX Heat-labile enterotoxin IIB, A chain OS=Escherichia coli PE=1 SV=2 34 212 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P01555|CHTA_VIBCH Cholera enterotoxin subunit A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ctxA PE=1 SV=1 33 209 2.0E-16
sp|P43530|ELAH_ECOH1 Heat-labile enterotoxin A chain OS=Escherichia coli O78:H11 (strain H10407 / ETEC) GN=eltA PE=3 SV=1 24 228 1.0E-15
sp|P06717|ELAP_ECOLX Heat-labile enterotoxin A chain OS=Escherichia coli GN=eltA PE=1 SV=1 24 228 2.0E-15
sp|P13810|E2AA_ECOLX Heat-labile enterotoxin IIA, A chain OS=Escherichia coli PE=3 SV=1 34 215 1.0E-14
sp|P43528|E2BA_ECOLX Heat-labile enterotoxin IIB, A chain OS=Escherichia coli PE=1 SV=2 34 212 2.0E-13
sp|A2PU44|CHELT_VIBCL NAD(+)--arginine ADP-ribosyltransferase Chelt OS=Vibrio cholerae GN=A51_B1772 PE=1 SV=1 33 212 4.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0005615 extracellular space Yes
GO:0090729 toxin activity Yes
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6560
MHLFLILPWLILVLCGLDRVHGKPHFKHGPKIVYRGTTTPPDVVLQRGGFQPRNPRMAIVKGYLNPFSLYNHGQG
QPLNNAYAHSKSVYVSTSAKRRQAASFVTEGRGYVYHIRPTPNFINLNKSLGGKGFYSKIKMEEQEYSAMGGIRA
DQIMGWTELPQGANTPVKEYKFTKSHFYNRKYDKSRPSGPQPQLAGFPENSKAWRKRPWKLFHKEVSGKTLEEYA
MNFMADNGKIVGWTGSPPLLPMRSPNDIPLASEPGIFSTQKIGNAMAKQAGSLLTSETETAVAQRAGTLLASEAE
TLLTQETGASQGKGAKTLSTQEAGPSQGKEAKTLPPQEAAPAQGQKTKSWPRPQEATPQGQKTKVMPRPQEATWH
AQKAGSSAPKAKVQDMTTETVGSAWVDDAGASGGSEAAEANGAAEVAESSEMLGLTESLTFDDLLLGGIVEAFIL
*
Coding >OphauG2|6560
ATGCATCTGTTTCTCATTCTTCCATGGCTCATACTCGTACTCTGTGGCCTCGATCGAGTCCATGGCAAGCCACAC
TTCAAACACGGGCCCAAGATTGTCTACCGTGGAACCACGACGCCCCCCGATGTGGTCCTCCAGAGAGGCGGCTTC
CAGCCCAGGAACCCAAGAATGGCAATCGTCAAAGGCTACCTGAATCCCTTTAGCCTCTATAACCACGGCCAAGGG
CAGCCATTGAACAATGCTTACGCACACTCGAAATCAGTCTACGTTTCCACTTCAGCAAAGCGTCGACAGGCAGCG
TCCTTTGTGACCGAGGGGAGAGGCTACGTCTACCATATCCGACCAACACCAAACTTTATCAACTTGAACAAGAGC
CTTGGAGGCAAAGGATTCTACAGCAAGATAAAAATGGAAGAACAGGAATACTCAGCCATGGGCGGAATACGCGCT
GACCAAATCATGGGATGGACCGAGCTGCCCCAAGGAGCCAATACCCCAGTAAAGGAGTACAAATTCACAAAGAGT
CATTTCTACAACAGAAAATACGACAAGTCCCGGCCCAGCGGACCGCAGCCCCAGCTTGCTGGCTTCCCTGAAAAT
TCAAAGGCCTGGCGTAAGCGCCCGTGGAAGCTGTTCCACAAAGAGGTCTCTGGCAAGACACTTGAAGAGTATGCC
ATGAACTTTATGGCCGATAATGGAAAGATTGTTGGCTGGACAGGATCCCCGCCTTTGCTGCCCATGCGGAGTCCC
AATGATATACCCCTGGCTTCAGAACCTGGAATTTTCTCAACTCAAAAAATAGGGAATGCAATGGCCAAGCAAGCT
GGGAGTTTACTGACTTCAGAAACAGAGACTGCAGTTGCTCAAAGGGCAGGGACTTTGCTCGCTTCAGAAGCAGAG
ACTTTACTGACTCAAGAAACAGGCGCATCGCAAGGCAAAGGCGCAAAGACCTTGTCGACTCAAGAAGCAGGACCC
TCACAGGGTAAAGAAGCAAAGACTTTGCCACCACAAGAAGCAGCACCGGCACAGGGCCAAAAAACAAAGTCTTGG
CCACGTCCACAAGAAGCAACGCCACAGGGCCAAAAAACAAAGGTTATGCCACGTCCACAAGAAGCAACATGGCAT
GCTCAAAAAGCAGGCAGCTCTGCTCCAAAGGCAAAGGTCCAAGACATGACAACCGAGACTGTGGGATCTGCTTGG
GTTGATGATGCTGGAGCTAGCGGGGGCTCCGAGGCGGCGGAAGCAAATGGGGCTGCCGAGGTGGCTGAGTCGAGC
GAAATGTTGGGACTGACTGAATCTCTAACATTTGATGATTTGTTGCTGGGAGGGATTGTCGAAGCTTTTATACTT
TGA
Transcript >OphauG2|6560
ATGCATCTGTTTCTCATTCTTCCATGGCTCATACTCGTACTCTGTGGCCTCGATCGAGTCCATGGCAAGCCACAC
TTCAAACACGGGCCCAAGATTGTCTACCGTGGAACCACGACGCCCCCCGATGTGGTCCTCCAGAGAGGCGGCTTC
CAGCCCAGGAACCCAAGAATGGCAATCGTCAAAGGCTACCTGAATCCCTTTAGCCTCTATAACCACGGCCAAGGG
CAGCCATTGAACAATGCTTACGCACACTCGAAATCAGTCTACGTTTCCACTTCAGCAAAGCGTCGACAGGCAGCG
TCCTTTGTGACCGAGGGGAGAGGCTACGTCTACCATATCCGACCAACACCAAACTTTATCAACTTGAACAAGAGC
CTTGGAGGCAAAGGATTCTACAGCAAGATAAAAATGGAAGAACAGGAATACTCAGCCATGGGCGGAATACGCGCT
GACCAAATCATGGGATGGACCGAGCTGCCCCAAGGAGCCAATACCCCAGTAAAGGAGTACAAATTCACAAAGAGT
CATTTCTACAACAGAAAATACGACAAGTCCCGGCCCAGCGGACCGCAGCCCCAGCTTGCTGGCTTCCCTGAAAAT
TCAAAGGCCTGGCGTAAGCGCCCGTGGAAGCTGTTCCACAAAGAGGTCTCTGGCAAGACACTTGAAGAGTATGCC
ATGAACTTTATGGCCGATAATGGAAAGATTGTTGGCTGGACAGGATCCCCGCCTTTGCTGCCCATGCGGAGTCCC
AATGATATACCCCTGGCTTCAGAACCTGGAATTTTCTCAACTCAAAAAATAGGGAATGCAATGGCCAAGCAAGCT
GGGAGTTTACTGACTTCAGAAACAGAGACTGCAGTTGCTCAAAGGGCAGGGACTTTGCTCGCTTCAGAAGCAGAG
ACTTTACTGACTCAAGAAACAGGCGCATCGCAAGGCAAAGGCGCAAAGACCTTGTCGACTCAAGAAGCAGGACCC
TCACAGGGTAAAGAAGCAAAGACTTTGCCACCACAAGAAGCAGCACCGGCACAGGGCCAAAAAACAAAGTCTTGG
CCACGTCCACAAGAAGCAACGCCACAGGGCCAAAAAACAAAGGTTATGCCACGTCCACAAGAAGCAACATGGCAT
GCTCAAAAAGCAGGCAGCTCTGCTCCAAAGGCAAAGGTCCAAGACATGACAACCGAGACTGTGGGATCTGCTTGG
GTTGATGATGCTGGAGCTAGCGGGGGCTCCGAGGCGGCGGAAGCAAATGGGGCTGCCGAGGTGGCTGAGTCGAGC
GAAATGTTGGGACTGACTGAATCTCTAACATTTGATGATTTGTTGCTGGGAGGGATTGTCGAAGCTTTTATACTT
TGA
Gene >OphauG2|6560
ATGCATCTGTTTCTCATTCTTCCATGGCTCATACTCGTACTCTGTGGCCTCGATCGAGTCCATGGCAAGCCACAC
TTCAAACACGGGCCCAAGATTGTCTACCGTGGAACCACGACGCCCCCCGATGTGGTCCTCCAGAGAGGCGGCTTC
CAGCCCAGGAACCCAAGAATGGCAATCGTCAAAGGCTACCTGAATCCCTTTAGCCTCTATAACCACGGCCAAGGG
CAGCCATTGAACAATGCTTACGCACACTCGAAATCAGTCTACGTTTCCACTTCAGCAAAGCGTCGACAGGCAGCG
TCCTTTGTGACCGAGGGGAGAGGCTACGTCTACCATATCCGACCAACACCAAACTTTATCAACTTGAACAAGAGC
CTTGGAGGCAAAGGATTCTACAGCAAGATAAAAATGGAAGAACAGGAATACTCAGCCATGGGCGGAATACGCGCT
GACCAAATCATGGGATGGACCGAGCTGCCCCAAGGAGCCAATACCCCAGTAAAGGAGTACAAATTCACAAAGAGT
CATTTCTACAACAGAAAATACGACAAGTCCCGGCCCAGCGGACCGCAGCCCCAGCTTGCTGGCTTCCCTGAAAAT
TCAAAGGCCTGGCGTAAGCGCCCGTGGAAGCTGTTCCACAAAGAGGTCTCTGGCAAGACACTTGAAGAGTATGCC
ATGAACTTTATGGCCGATAATGGAAAGATTGTTGGCTGGACAGGATCCCCGCCTTTGCTGCCCATGCGGAGTCCC
AATGATATACCCCTGGCTTCAGAACCTGGAATTTTCTCAACTCAAAAAATAGGGAATGCAATGGCCAAGCAAGCT
GGGAGTTTACTGACTTCAGAAACAGAGACTGCAGTTGCTCAAAGGGCAGGGACTTTGCTCGCTTCAGAAGCAGAG
ACTTTACTGACTCAAGAAACAGGCGCATCGCAAGGCAAAGGCGCAAAGACCTTGTCGACTCAAGAAGCAGGACCC
TCACAGGGTAAAGAAGCAAAGACTTTGCCACCACAAGAAGCAGCACCGGCACAGGGCCAAAAAACAAAGTCTTGG
CCACGTCCACAAGAAGCAACGCCACAGGGCCAAAAAACAAAGGTTATGCCACGTCCACAAGAAGCAACATGGCAT
GCTCAAAAAGCAGGCAGCTCTGCTCCAAAGGCAAAGGTCCAAGACATGACAACCGAGACTGTGGGATCTGCTTGG
GTTGATGATGCTGGAGCTAGCGGGGGCTCCGAGGCGGCGGAAGCAAATGGGGCTGCCGAGGTGGCTGAGTCGAGC
GAAATGTTGGGACTGACTGAATCTCTAACATTTGATGATTTGTTGCTGGGAGGGATTGTCGAAGCTTTTATACTT
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail