Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6517
Gene name
LocationContig_68:11172..12363
Strand-
Gene length (bp)1191
Transcript length (bp)1026
Coding sequence length (bp)1026
Protein length (aa) 342

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00650 CRAL_TRIO CRAL/TRIO domain 6.0E-36 103 264
PF03765 CRAL_TRIO_N CRAL/TRIO, N-terminal domain 8.8E-08 49 76

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10137|SEC14_SCHPO Sec14 cytosolic factor OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec14 PE=3 SV=1 12 285 2.0E-120
sp|P24859|SEC14_KLULA SEC14 cytosolic factor OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC14 PE=3 SV=2 21 288 2.0E-113
sp|Q75DK1|SEC14_ASHGO SEC14 cytosolic factor OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC14 PE=3 SV=2 16 288 9.0E-111
sp|P53989|SEC14_CANGA SEC14 cytosolic factor OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC14 PE=3 SV=1 22 288 4.0E-110
sp|P24280|SEC14_YEAST SEC14 cytosolic factor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC14 PE=1 SV=3 19 288 1.0E-105
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10137|SEC14_SCHPO Sec14 cytosolic factor OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec14 PE=3 SV=1 12 285 2.0E-120
sp|P24859|SEC14_KLULA SEC14 cytosolic factor OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC14 PE=3 SV=2 21 288 2.0E-113
sp|Q75DK1|SEC14_ASHGO SEC14 cytosolic factor OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC14 PE=3 SV=2 16 288 9.0E-111
sp|P53989|SEC14_CANGA SEC14 cytosolic factor OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC14 PE=3 SV=1 22 288 4.0E-110
sp|P24280|SEC14_YEAST SEC14 cytosolic factor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC14 PE=1 SV=3 19 288 1.0E-105
sp|P45816|SEC14_YARLI SEC14 cytosolic factor OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC14 PE=3 SV=2 1 288 2.0E-103
sp|P46250|SEC14_CANAL SEC14 cytosolic factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC14 PE=2 SV=1 15 288 1.0E-94
sp|P33324|YKJ1_YEAST CRAL-TRIO domain-containing protein YKL091C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKL091C PE=1 SV=2 16 288 6.0E-90
sp|Q93ZE9|SFH3_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH3 OS=Arabidopsis thaliana GN=SFH3 PE=2 SV=1 52 282 4.0E-62
sp|F4JVA9|SFH2_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH2 OS=Arabidopsis thaliana GN=SFH2 PE=2 SV=1 52 282 1.0E-61
sp|F4JLE5|SFH1_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH1 OS=Arabidopsis thaliana GN=SFH1 PE=2 SV=1 49 282 6.0E-61
sp|Q94A34|SFH12_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH12 OS=Arabidopsis thaliana GN=SFH12 PE=2 SV=1 52 281 3.0E-58
sp|Q9SI13|SFH10_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH10 OS=Arabidopsis thaliana GN=SFH10 PE=3 SV=1 52 280 9.0E-58
sp|F4HP88|SFH4_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH4 OS=Arabidopsis thaliana GN=SFH4 PE=2 SV=1 52 283 3.0E-56
sp|F4JVA6|SFH6_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH6 OS=Arabidopsis thaliana GN=SFH6 PE=2 SV=1 52 281 9.0E-55
sp|Q9SIW3|SFH7_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH7 OS=Arabidopsis thaliana GN=SFH7 PE=2 SV=2 52 290 3.0E-54
sp|F4IHJ0|SFH8_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH8 OS=Arabidopsis thaliana GN=SFH8 PE=2 SV=1 52 281 7.0E-54
sp|F4J7S8|SFH9_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH9 OS=Arabidopsis thaliana GN=SFH9 PE=2 SV=1 52 282 6.0E-53
sp|F4JYJ3|SFH11_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH11 OS=Arabidopsis thaliana GN=SFH11 PE=3 SV=1 35 282 2.0E-51
sp|Q8GXC6|SFH5_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH5 OS=Arabidopsis thaliana GN=SFH5 PE=2 SV=1 29 282 4.0E-51
sp|F4K6D3|SFH14_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH14 OS=Arabidopsis thaliana GN=SFH14 PE=2 SV=1 56 282 2.0E-43
sp|Q501H5|SFH13_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH13 OS=Arabidopsis thaliana GN=SFH13 PE=2 SV=1 39 282 5.0E-41
sp|Q16KN5|RETM_AEDAE Protein real-time OS=Aedes aegypti GN=retm PE=3 SV=1 23 266 3.0E-26
sp|Q29JQ0|RETM_DROPS Protein real-time OS=Drosophila pseudoobscura pseudoobscura GN=retm PE=3 SV=1 25 267 7.0E-25
sp|Q9VMD6|RETM_DROME Protein real-time OS=Drosophila melanogaster GN=retm PE=1 SV=2 25 267 3.0E-24
sp|Q7PWB1|RETM_ANOGA Protein real-time OS=Anopheles gambiae GN=retm PE=3 SV=4 23 269 1.0E-22
sp|Q03606|YN02_CAEEL CRAL-TRIO domain-containing protein T23G5.2 OS=Caenorhabditis elegans GN=T23G5.2 PE=3 SV=3 25 266 1.0E-22
sp|Q0V9N0|S14L5_XENTR SEC14-like protein 5 OS=Xenopus tropicalis GN=sec14l1 PE=2 SV=1 23 268 1.0E-21
sp|O43304|S14L5_HUMAN SEC14-like protein 5 OS=Homo sapiens GN=SEC14L5 PE=2 SV=3 25 271 3.0E-21
sp|Q8R0F9|S14L4_MOUSE SEC14-like protein 4 OS=Mus musculus GN=Sec14l4 PE=1 SV=1 22 271 1.0E-20
sp|Q99MS0|S14L2_RAT SEC14-like protein 2 OS=Rattus norvegicus GN=Sec14l2 PE=1 SV=1 21 271 2.0E-20
sp|Q92503|S14L1_HUMAN SEC14-like protein 1 OS=Homo sapiens GN=SEC14L1 PE=1 SV=2 23 268 2.0E-20
sp|Q99J08|S14L2_MOUSE SEC14-like protein 2 OS=Mus musculus GN=Sec14l2 PE=1 SV=1 21 271 3.0E-20
sp|Q9UDX3|S14L4_HUMAN SEC14-like protein 4 OS=Homo sapiens GN=SEC14L4 PE=1 SV=1 21 271 4.0E-20
sp|O76054|S14L2_HUMAN SEC14-like protein 2 OS=Homo sapiens GN=SEC14L2 PE=1 SV=1 21 271 6.0E-20
sp|P58875|S14L2_BOVIN SEC14-like protein 2 OS=Bos taurus GN=SEC14L2 PE=1 SV=2 21 271 5.0E-19
sp|Q9Z1J8|S14L3_RAT SEC14-like protein 3 OS=Rattus norvegicus GN=Sec14l3 PE=1 SV=1 21 271 2.0E-17
sp|Q9UDX4|S14L3_HUMAN SEC14-like protein 3 OS=Homo sapiens GN=SEC14L3 PE=1 SV=1 21 271 2.0E-17
sp|B5MCN3|S14L6_HUMAN Putative SEC14-like protein 6 OS=Homo sapiens GN=SEC14L6 PE=5 SV=1 21 271 2.0E-16
sp|Q757H2|CSR1_ASHGO Phosphatidylinositol transfer protein CSR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSR1 PE=3 SV=2 56 267 7.0E-16
sp|Q10138|YAS2_SCHPO CRAL-TRIO domain-containing protein C3H8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H8.02 PE=1 SV=1 56 274 8.0E-16
sp|Q56Z59|PATL3_ARATH Patellin-3 OS=Arabidopsis thaliana GN=PATL3 PE=1 SV=2 54 273 8.0E-15
sp|Q9UU99|YJX4_SCHPO CRAL-TRIO domain-containing protein C23B6.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC23B6.04c PE=1 SV=1 56 265 7.0E-12
sp|Q06705|CSR1_YEAST Phosphatidylinositol transfer protein CSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSR1 PE=1 SV=1 55 264 2.0E-11
sp|P49193|RALB_TODPA Retinal-binding protein OS=Todarodes pacificus PE=1 SV=2 113 265 5.0E-11
sp|Q9M0R2|PATL5_ARATH Patellin-5 OS=Arabidopsis thaliana GN=PATL5 PE=1 SV=2 20 278 1.0E-10
sp|P41034|TTPA_RAT Alpha-tocopherol transfer protein OS=Rattus norvegicus GN=Ttpa PE=1 SV=1 37 265 2.0E-10
sp|Q9SCU1|PATL6_ARATH Patellin-6 OS=Arabidopsis thaliana GN=PATL6 PE=2 SV=1 54 284 2.0E-09
sp|P10123|RLBP1_BOVIN Retinaldehyde-binding protein 1 OS=Bos taurus GN=RLBP1 PE=1 SV=4 52 265 1.0E-08
sp|Q55CU8|RSC5_DICDI Random slug protein 5 OS=Dictyostelium discoideum GN=rsc5 PE=2 SV=1 54 267 1.0E-08
sp|Q9HDZ5|YKP9_SCHPO CRAL-TRIO domain-containing protein C589.09, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC589.09 PE=3 SV=1 56 264 1.0E-08
sp|Q19895|YUQP_CAEEL CRAL-TRIO domain-containing protein F28H7.8 OS=Caenorhabditis elegans GN=F28H7.8 PE=3 SV=2 33 305 3.0E-08
sp|Q56WK6|PATL1_ARATH Patellin-1 OS=Arabidopsis thaliana GN=PATL1 PE=1 SV=2 54 264 2.0E-07
sp|P53844|PDR17_YEAST Phosphatidylinositol transfer protein PDR17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR17 PE=1 SV=1 56 237 5.0E-07
sp|Q56ZI2|PATL2_ARATH Patellin-2 OS=Arabidopsis thaliana GN=PATL2 PE=1 SV=2 54 264 3.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1932
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6517 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7615
Ophiocordyceps camponoti-floridani Ophcf2|00547
Ophiocordyceps camponoti-rufipedis Ophun1|3379
Ophiocordyceps kimflemingae Ophio5|4814
Ophiocordyceps subramaniannii Hirsu2|2066

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6517
MDISEKHDDYDFPHTAANPDSGHAGNLSTDQIAKVHQLRMMLEAEGYTSRLDTLTMLRFLRARKWDVALAKQMFI
DCEKWRKETKLDETVPIWDYPEKPEVAKYYKQFYHKTDNDGRPIYIETLGGIDLTAMYKITTADRMLTNLAVEYE
RLADPRLPACSRKADKLLETCCTIMDLKGVTLTKVPQVYSYVRQASVISQNYYPERLGKLYMINAPWGFSTVWSV
VKGWLDPVTVAKIHILGSGYKTELLKQVPAESLPKEFGGTCECPGGCQNSDTGPWREAAWSKPAKWEKEQKTGKE
DKTAATKPVETAGAHAPPAVTAGDESNPIAPLDETKQAAAA*
Coding >OphauG2|6517
ATGGACATTAGCGAAAAGCACGATGATTACGATTTCCCCCACACCGCCGCCAACCCTGACAGTGGCCACGCTGGC
AATCTGTCCACGGACCAGATCGCCAAGGTGCACCAGCTCCGAATGATGCTCGAGGCTGAGGGATACACGAGCAGA
CTCGACACCCTGACCATGCTGCGATTTCTGCGCGCACGCAAATGGGATGTTGCTCTAGCCAAGCAGATGTTCATC
GACTGCGAGAAATGGCGCAAGGAAACCAAGCTCGACGAGACTGTTCCCATCTGGGACTACCCTGAAAAGCCCGAG
GTGGCTAAGTATTACAAGCAGTTTTACCACAAGACGGACAATGATGGACGCCCCATCTACATTGAGACACTGGGC
GGCATTGACCTTACCGCCATGTATAAAATCACAACGGCCGATCGCATGCTCACCAATTTGGCCGTCGAGTATGAG
CGTCTCGCCGATCCCCGCCTGCCCGCTTGCTCTCGCAAGGCCGACAAGCTGCTCGAGACTTGCTGCACCATCATG
GACCTCAAGGGCGTCACCCTTACCAAGGTGCCTCAAGTCTACTCGTACGTCCGCCAGGCCTCGGTGATTTCGCAA
AACTACTATCCCGAGCGGCTAGGCAAGCTGTACATGATCAATGCTCCTTGGGGCTTTTCCACTGTCTGGAGCGTC
GTCAAGGGCTGGCTGGACCCCGTCACGGTTGCCAAAATCCACATCCTCGGCTCCGGATACAAGACTGAACTGCTC
AAGCAAGTGCCTGCTGAAAGCCTGCCCAAGGAATTTGGCGGCACGTGTGAGTGTCCTGGCGGCTGCCAAAACAGC
GATACCGGCCCCTGGCGCGAAGCAGCGTGGTCCAAGCCTGCCAAGTGGGAAAAGGAGCAGAAGACGGGCAAGGAG
GACAAGACGGCCGCGACAAAGCCCGTCGAGACGGCTGGGGCCCACGCACCGCCCGCCGTCACGGCTGGTGATGAG
TCTAACCCCATTGCGCCGCTTGATGAGACCAAGCAGGCAGCTGCCGCCTAG
Transcript >OphauG2|6517
ATGGACATTAGCGAAAAGCACGATGATTACGATTTCCCCCACACCGCCGCCAACCCTGACAGTGGCCACGCTGGC
AATCTGTCCACGGACCAGATCGCCAAGGTGCACCAGCTCCGAATGATGCTCGAGGCTGAGGGATACACGAGCAGA
CTCGACACCCTGACCATGCTGCGATTTCTGCGCGCACGCAAATGGGATGTTGCTCTAGCCAAGCAGATGTTCATC
GACTGCGAGAAATGGCGCAAGGAAACCAAGCTCGACGAGACTGTTCCCATCTGGGACTACCCTGAAAAGCCCGAG
GTGGCTAAGTATTACAAGCAGTTTTACCACAAGACGGACAATGATGGACGCCCCATCTACATTGAGACACTGGGC
GGCATTGACCTTACCGCCATGTATAAAATCACAACGGCCGATCGCATGCTCACCAATTTGGCCGTCGAGTATGAG
CGTCTCGCCGATCCCCGCCTGCCCGCTTGCTCTCGCAAGGCCGACAAGCTGCTCGAGACTTGCTGCACCATCATG
GACCTCAAGGGCGTCACCCTTACCAAGGTGCCTCAAGTCTACTCGTACGTCCGCCAGGCCTCGGTGATTTCGCAA
AACTACTATCCCGAGCGGCTAGGCAAGCTGTACATGATCAATGCTCCTTGGGGCTTTTCCACTGTCTGGAGCGTC
GTCAAGGGCTGGCTGGACCCCGTCACGGTTGCCAAAATCCACATCCTCGGCTCCGGATACAAGACTGAACTGCTC
AAGCAAGTGCCTGCTGAAAGCCTGCCCAAGGAATTTGGCGGCACGTGTGAGTGTCCTGGCGGCTGCCAAAACAGC
GATACCGGCCCCTGGCGCGAAGCAGCGTGGTCCAAGCCTGCCAAGTGGGAAAAGGAGCAGAAGACGGGCAAGGAG
GACAAGACGGCCGCGACAAAGCCCGTCGAGACGGCTGGGGCCCACGCACCGCCCGCCGTCACGGCTGGTGATGAG
TCTAACCCCATTGCGCCGCTTGATGAGACCAAGCAGGCAGCTGCCGCCTAG
Gene >OphauG2|6517
ATGGACATTAGCGAAAAGCACGATGATTACGATTTCCCCCACACCGCCGCCAACCCTGACAGTGGCCACGCTGGC
AATCTGTCCACGGACCAGATCGCCAAGGTGCACCAGCTCCGAATGATGCTCGAGGCTGAGGGATACACGAGCAGA
CTCGACACCCTGACCATGGTAAGCTCGGCCCTGCCACCCGCTCCTTTGACCAATACGTCTGACGCCCGTTTGCAG
CTGCGATTTCTGCGCGCACGCAAATGGGATGTTGCTCTAGCCAAGCAGATGTAGGAGCCCAACATGTTGTGCGCT
GGACCTTTCCGGGGAACTGATTGGGGCCAGGTTCATCGACTGCGAGAAATGGCGCAAGGAAACCAAGCTCGACGA
GACTGTTCCCATCTGGGACTACCCTGAAAAGCCCGAGGTGGCTAAGTATTACAAGCAGTTTTACCACAAGACGGA
CAATGTGCGGCAAGCCTGCCTAATTGAGCCTGCCGAGTGCTAATTTGTTTGCCCCAGGATGGACGCCCCATCTAC
ATTGAGACACTGGGCGGCATTGACCTTACCGCCATGTATAAAATCACAACGGCCGATCGCATGCTCACCAATTTG
GCCGTCGAGTATGAGCGTCTCGCCGATCCCCGCCTGCCCGCTTGCTCTCGCAAGGCCGACAAGCTGCTCGAGACT
TGCTGCACCATCATGGACCTCAAGGGCGTCACCCTTACCAAGGTGCCTCAAGTCTACTCGTACGTCCGCCAGGCC
TCGGTGATTTCGCAAAACTACTATCCCGAGCGGCTAGGCAAGCTGTACATGATCAATGCTCCTTGGGGCTTTTCC
ACTGTCTGGAGCGTCGTCAAGGGCTGGCTGGACCCCGTCACGGTTGCCAAAATCCACATCCTCGGCTCCGGATAC
AAGACTGAACTGCTCAAGCAAGTGCCTGCTGAAAGCCTGCCCAAGGAATTTGGCGGCACGTGTGAGTGTCCTGGC
GGCTGCCAAAACAGCGATACCGGCCCCTGGCGCGAAGCAGCGTGGTCCAAGCCTGCCAAGTGGGAAAAGGAGCAG
AAGACGGGCAAGGAGGACAAGACGGCCGCGACAAAGCCCGTCGAGACGGCTGGGGCCCACGCACCGCCCGCCGTC
ACGGCTGGTGATGAGTCTAACCCCATTGCGCCGCTTGATGAGACCAAGCAGGCAGCTGCCGCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail