Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6478
Gene name
LocationContig_670:5683..9380
Strand+
Gene length (bp)3697
Transcript length (bp)3636
Coding sequence length (bp)3636
Protein length (aa) 1212

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08578 DUF1765 Protein of unknown function (DUF1765) 3.1E-44 705 827

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14260|YFP3_SCHPO UPF0592 membrane protein C7D4.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC7D4.03c PE=3 SV=1 292 887 2.0E-39

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6478
MTASAVQQPPRFFPRSHSTPDLLSRGPSTNSNQDGDWNTWSEPAFEVPSFNSDFELDTSLLTNSRPVTRPHEDQA
AFDSPRKPSLARSKAASFLDRQRSWLLSTSRPTKDAANNEPHDGADNGGASRRDVAHARLSERGATHSSSGSLAN
FASKWSWSTTSLSSLKATSESSGSKPLLRAATTRHAKASPKSSQSVSDAPKAKSADQGRTGTHSPTPPLGPLARS
GSYLSKARQKPPVLVSRGNDGSLDSDMSCASSSTSLANRRSSDKTSTTQSMCSDGNTNTPMTDEYSNDAMPSTIA
LRDPLWSSFQNLDVDFKNFGSKQTSSRISQVKNTLVPFLRNTGDSKLIKRLSLEDIERRSTILNKWWGAILDMLQ
DRGQHPVPGIERPVLLEAATLLMMRTEWRQATSHFQPLVDRSPNERVQAKCQSKDFHSIQDAAHDTLLADSAEHN
VRTMFVMNLLKQMAYVVDRMSVRHAPLSLVNFSGKACAYAFFFAPGVADILVRLWGLTPELIRRAAEALGLPRVD
GGESDDIAALFPHNLGAFGWTSSRTIWDQLKKVPKMSLLVARIPWTGPWVSRWKGRDTDLFFIFCKYFHVLADQF
IPQGLPILEKARSPAFVVLHAQLLSILDTTIHRQMAMEHGSASPPLIDSVNGADASALALPLPPTNLMKGMAENR
LVVLLKDLLSDDAAEMLGARRTFAEAFACLLKGATCKTSQFNSTACFTLCDFVEEAINVYQEFETEDASTRHVDW
EFWLQVCKRIMQSLNTMSEVRTLSFIYAIWDAVARDPQRKETLCLDWLLTEQTFNALFNHWCPMVRAYYQRLLCW
RICRDDGSGSELDLEIMMVASARLRTAWSHYLYLKRSAEDAGRAGPSTAPTCPALGKRFMIIRHEVNAPQPGLFV
GFDSFARITSSDGLLVNSLCDGSQNGKGDSKKRWSLLGKVLSMTGSNTGGTGPSSPSLDVPARGHFTEYDLIGPR
RGTLEFLARPSSLAAQSGSTNANNARNSTPESDAGGLSPVFEERKYAFKFVLGWLQQPMPATGRDLTRPRLPAAA
HSQVIARGGRRSSYASQTRGRLAKEEVDEPAEKERRGLVNATVEEWLRGTSLAAMHPGEGKTKSNPDGRRSSVSA
EAPIRPRMAPWRGSQDTSRDLLVRAVKPQGIFASNSVYLGRALAEWALVVSECNNFVDRRCEEGVARPNEVEVPH
LGVEGFRKLGV*
Coding >OphauG2|6478
ATGACGGCCTCGGCCGTACAACAGCCACCGCGCTTCTTCCCTCGATCGCACTCGACCCCCGACTTGTTGTCCCGG
GGCCCCTCGACAAATTCCAACCAAGATGGAGACTGGAACACCTGGTCCGAGCCCGCCTTTGAGGTGCCCTCTTTC
AACTCGGATTTTGAGCTCGACACGTCCCTCTTGACCAATTCCCGCCCAGTCACGCGCCCCCATGAGGACCAAGCT
GCCTTCGACTCCCCACGCAAACCATCGCTGGCCCGCTCCAAGGCTGCCTCGTTTCTCGATCGCCAACGCTCGTGG
CTGCTTTCCACCTCGCGCCCAACCAAGGATGCTGCAAACAATGAGCCCCACGACGGGGCCGACAATGGCGGCGCT
TCGAGACGTGACGTAGCTCATGCACGATTATCGGAGCGAGGCGCCACGCATTCCTCGAGCGGCTCATTGGCCAAC
TTTGCCTCCAAATGGTCCTGGTCCACCACGTCTCTATCCTCCCTCAAGGCTACGTCAGAATCATCAGGCAGCAAG
CCGCTTCTCAGGGCTGCCACCACCAGACATGCCAAGGCGTCACCAAAAAGCAGCCAATCCGTGTCAGATGCTCCC
AAGGCAAAGTCCGCGGACCAAGGCCGCACAGGCACACATTCACCAACACCGCCATTGGGTCCTCTGGCCCGCTCG
GGTTCCTACTTGTCCAAGGCGAGGCAAAAGCCTCCTGTGCTCGTGTCGAGGGGCAATGATGGTAGCCTGGACTCG
GATATGAGCTGTGCATCATCGTCGACAAGCCTTGCCAATCGCCGTTCTAGCGACAAGACAAGCACAACGCAATCC
ATGTGCAGCGATGGCAACACAAATACACCAATGACGGATGAATATTCAAATGACGCAATGCCCTCCACTATTGCC
CTGCGTGACCCTCTGTGGTCGTCGTTTCAGAATCTCGACGTCGACTTTAAAAACTTTGGCTCAAAACAGACATCA
TCACGCATCAGTCAAGTCAAGAATACTCTGGTGCCTTTTTTGCGAAACACGGGCGATTCCAAATTGATCAAGCGA
TTGAGTCTCGAGGACATTGAGCGAAGAAGCACCATTCTGAACAAGTGGTGGGGCGCTATTCTCGACATGCTTCAA
GATCGAGGCCAACACCCTGTTCCCGGAATCGAGCGCCCCGTTTTACTCGAGGCGGCCACGCTGCTCATGATGAGG
ACGGAATGGCGCCAGGCGACCAGCCATTTCCAACCGCTTGTCGATCGCTCCCCAAACGAACGTGTTCAGGCCAAG
TGTCAAAGCAAAGACTTTCATTCCATTCAAGACGCGGCTCACGACACCTTGCTAGCCGACTCGGCCGAGCACAAC
GTGCGCACCATGTTTGTCATGAATCTACTCAAGCAAATGGCCTATGTTGTGGACAGAATGTCTGTGCGCCATGCG
CCTCTTAGCCTGGTCAATTTCTCGGGCAAGGCCTGCGCCTACGCCTTCTTCTTCGCCCCAGGCGTAGCCGATATT
CTTGTCCGATTGTGGGGCTTAACACCGGAGCTCATTCGCCGCGCCGCTGAAGCTCTTGGCCTCCCGAGGGTGGAT
GGTGGTGAAAGCGACGACATTGCCGCTCTTTTCCCCCACAACCTGGGCGCTTTTGGCTGGACTTCCTCACGAACT
ATATGGGATCAGCTCAAAAAGGTGCCCAAAATGTCTCTGCTCGTTGCCCGCATCCCGTGGACGGGCCCTTGGGTC
TCACGGTGGAAGGGCCGAGACACGGACCTATTCTTCATCTTTTGCAAGTATTTTCATGTTCTAGCGGATCAATTT
ATTCCCCAGGGACTGCCCATTCTGGAAAAGGCTCGTTCGCCCGCCTTTGTTGTGCTCCATGCTCAACTACTCTCC
ATACTTGACACCACTATTCACCGTCAGATGGCCATGGAGCACGGATCCGCCTCCCCTCCCTTGATCGACTCGGTC
AATGGAGCAGACGCCTCGGCTCTAGCCCTACCGCTGCCCCCCACAAATCTGATGAAGGGCATGGCTGAGAATAGG
CTGGTGGTGCTACTCAAGGACTTGCTTTCCGATGACGCTGCTGAGATGCTCGGAGCTCGGCGTACCTTTGCCGAG
GCTTTTGCCTGCCTGCTCAAGGGTGCTACATGCAAAACATCGCAGTTCAATAGCACCGCATGTTTTACGCTTTGT
GATTTTGTCGAAGAGGCCATTAATGTCTACCAAGAATTTGAGACTGAAGATGCGTCGACGCGCCATGTCGATTGG
GAGTTTTGGCTCCAGGTGTGCAAGCGCATCATGCAATCATTGAACACCATGTCTGAGGTGCGCACGCTGTCTTTT
ATATATGCCATTTGGGATGCAGTGGCCAGGGATCCACAACGAAAGGAAACGCTTTGCCTCGACTGGCTGCTCACT
GAACAAACATTTAATGCCTTGTTCAACCACTGGTGCCCCATGGTCCGAGCCTACTACCAGCGTCTTCTCTGTTGG
AGAATCTGCCGCGATGATGGGAGTGGCAGCGAGCTGGACTTAGAAATCATGATGGTGGCATCGGCGAGACTGCGG
ACTGCATGGTCACATTACCTATATCTGAAGCGAAGCGCAGAAGACGCTGGGCGAGCCGGTCCGTCGACGGCGCCT
ACTTGCCCGGCTCTTGGCAAAAGATTTATGATTATCCGTCACGAGGTTAATGCCCCTCAACCAGGATTGTTTGTT
GGCTTTGATAGCTTTGCTCGGATAACGAGCAGCGATGGACTGTTGGTCAACAGCCTCTGTGATGGCAGTCAAAAT
GGTAAAGGAGACTCCAAGAAGCGCTGGTCCTTGTTGGGCAAAGTCCTTTCCATGACTGGGAGCAATACTGGCGGC
ACTGGTCCATCATCGCCGAGCTTGGACGTGCCTGCGCGAGGCCATTTTACGGAATATGATCTCATTGGTCCTCGT
AGAGGAACGCTGGAATTTTTGGCCCGCCCTTCCTCGCTTGCGGCTCAATCGGGCAGCACAAACGCCAATAATGCT
CGAAATTCCACGCCCGAGTCTGATGCTGGAGGACTGTCGCCGGTTTTTGAGGAGCGCAAATATGCGTTCAAGTTT
GTATTGGGTTGGCTTCAGCAGCCCATGCCGGCTACAGGGCGTGATCTTACGCGTCCTCGACTTCCGGCTGCAGCT
CATTCGCAAGTCATTGCTAGAGGAGGGAGGCGCTCGTCTTATGCCTCCCAGACCCGCGGACGACTAGCCAAGGAG
GAGGTTGACGAGCCAGCGGAAAAGGAGCGAAGAGGTTTGGTGAATGCTACTGTAGAGGAGTGGCTTCGCGGCACC
TCACTTGCAGCAATGCACCCCGGTGAAGGGAAAACAAAGTCGAACCCGGACGGCAGAAGAAGCAGCGTTTCAGCA
GAGGCACCAATTCGACCTCGAATGGCTCCTTGGCGGGGGAGCCAGGACACGAGCCGGGATCTCTTGGTCAGGGCA
GTCAAACCCCAAGGGATATTTGCCAGTAACTCGGTCTACTTGGGCCGAGCTTTGGCTGAATGGGCTCTTGTAGTT
TCAGAGTGTAATAACTTTGTGGATCGGCGCTGCGAAGAGGGTGTTGCACGCCCCAACGAGGTCGAGGTTCCACAT
CTCGGAGTGGAGGGATTCCGCAAGTTGGGCGTCTAG
Transcript >OphauG2|6478
ATGACGGCCTCGGCCGTACAACAGCCACCGCGCTTCTTCCCTCGATCGCACTCGACCCCCGACTTGTTGTCCCGG
GGCCCCTCGACAAATTCCAACCAAGATGGAGACTGGAACACCTGGTCCGAGCCCGCCTTTGAGGTGCCCTCTTTC
AACTCGGATTTTGAGCTCGACACGTCCCTCTTGACCAATTCCCGCCCAGTCACGCGCCCCCATGAGGACCAAGCT
GCCTTCGACTCCCCACGCAAACCATCGCTGGCCCGCTCCAAGGCTGCCTCGTTTCTCGATCGCCAACGCTCGTGG
CTGCTTTCCACCTCGCGCCCAACCAAGGATGCTGCAAACAATGAGCCCCACGACGGGGCCGACAATGGCGGCGCT
TCGAGACGTGACGTAGCTCATGCACGATTATCGGAGCGAGGCGCCACGCATTCCTCGAGCGGCTCATTGGCCAAC
TTTGCCTCCAAATGGTCCTGGTCCACCACGTCTCTATCCTCCCTCAAGGCTACGTCAGAATCATCAGGCAGCAAG
CCGCTTCTCAGGGCTGCCACCACCAGACATGCCAAGGCGTCACCAAAAAGCAGCCAATCCGTGTCAGATGCTCCC
AAGGCAAAGTCCGCGGACCAAGGCCGCACAGGCACACATTCACCAACACCGCCATTGGGTCCTCTGGCCCGCTCG
GGTTCCTACTTGTCCAAGGCGAGGCAAAAGCCTCCTGTGCTCGTGTCGAGGGGCAATGATGGTAGCCTGGACTCG
GATATGAGCTGTGCATCATCGTCGACAAGCCTTGCCAATCGCCGTTCTAGCGACAAGACAAGCACAACGCAATCC
ATGTGCAGCGATGGCAACACAAATACACCAATGACGGATGAATATTCAAATGACGCAATGCCCTCCACTATTGCC
CTGCGTGACCCTCTGTGGTCGTCGTTTCAGAATCTCGACGTCGACTTTAAAAACTTTGGCTCAAAACAGACATCA
TCACGCATCAGTCAAGTCAAGAATACTCTGGTGCCTTTTTTGCGAAACACGGGCGATTCCAAATTGATCAAGCGA
TTGAGTCTCGAGGACATTGAGCGAAGAAGCACCATTCTGAACAAGTGGTGGGGCGCTATTCTCGACATGCTTCAA
GATCGAGGCCAACACCCTGTTCCCGGAATCGAGCGCCCCGTTTTACTCGAGGCGGCCACGCTGCTCATGATGAGG
ACGGAATGGCGCCAGGCGACCAGCCATTTCCAACCGCTTGTCGATCGCTCCCCAAACGAACGTGTTCAGGCCAAG
TGTCAAAGCAAAGACTTTCATTCCATTCAAGACGCGGCTCACGACACCTTGCTAGCCGACTCGGCCGAGCACAAC
GTGCGCACCATGTTTGTCATGAATCTACTCAAGCAAATGGCCTATGTTGTGGACAGAATGTCTGTGCGCCATGCG
CCTCTTAGCCTGGTCAATTTCTCGGGCAAGGCCTGCGCCTACGCCTTCTTCTTCGCCCCAGGCGTAGCCGATATT
CTTGTCCGATTGTGGGGCTTAACACCGGAGCTCATTCGCCGCGCCGCTGAAGCTCTTGGCCTCCCGAGGGTGGAT
GGTGGTGAAAGCGACGACATTGCCGCTCTTTTCCCCCACAACCTGGGCGCTTTTGGCTGGACTTCCTCACGAACT
ATATGGGATCAGCTCAAAAAGGTGCCCAAAATGTCTCTGCTCGTTGCCCGCATCCCGTGGACGGGCCCTTGGGTC
TCACGGTGGAAGGGCCGAGACACGGACCTATTCTTCATCTTTTGCAAGTATTTTCATGTTCTAGCGGATCAATTT
ATTCCCCAGGGACTGCCCATTCTGGAAAAGGCTCGTTCGCCCGCCTTTGTTGTGCTCCATGCTCAACTACTCTCC
ATACTTGACACCACTATTCACCGTCAGATGGCCATGGAGCACGGATCCGCCTCCCCTCCCTTGATCGACTCGGTC
AATGGAGCAGACGCCTCGGCTCTAGCCCTACCGCTGCCCCCCACAAATCTGATGAAGGGCATGGCTGAGAATAGG
CTGGTGGTGCTACTCAAGGACTTGCTTTCCGATGACGCTGCTGAGATGCTCGGAGCTCGGCGTACCTTTGCCGAG
GCTTTTGCCTGCCTGCTCAAGGGTGCTACATGCAAAACATCGCAGTTCAATAGCACCGCATGTTTTACGCTTTGT
GATTTTGTCGAAGAGGCCATTAATGTCTACCAAGAATTTGAGACTGAAGATGCGTCGACGCGCCATGTCGATTGG
GAGTTTTGGCTCCAGGTGTGCAAGCGCATCATGCAATCATTGAACACCATGTCTGAGGTGCGCACGCTGTCTTTT
ATATATGCCATTTGGGATGCAGTGGCCAGGGATCCACAACGAAAGGAAACGCTTTGCCTCGACTGGCTGCTCACT
GAACAAACATTTAATGCCTTGTTCAACCACTGGTGCCCCATGGTCCGAGCCTACTACCAGCGTCTTCTCTGTTGG
AGAATCTGCCGCGATGATGGGAGTGGCAGCGAGCTGGACTTAGAAATCATGATGGTGGCATCGGCGAGACTGCGG
ACTGCATGGTCACATTACCTATATCTGAAGCGAAGCGCAGAAGACGCTGGGCGAGCCGGTCCGTCGACGGCGCCT
ACTTGCCCGGCTCTTGGCAAAAGATTTATGATTATCCGTCACGAGGTTAATGCCCCTCAACCAGGATTGTTTGTT
GGCTTTGATAGCTTTGCTCGGATAACGAGCAGCGATGGACTGTTGGTCAACAGCCTCTGTGATGGCAGTCAAAAT
GGTAAAGGAGACTCCAAGAAGCGCTGGTCCTTGTTGGGCAAAGTCCTTTCCATGACTGGGAGCAATACTGGCGGC
ACTGGTCCATCATCGCCGAGCTTGGACGTGCCTGCGCGAGGCCATTTTACGGAATATGATCTCATTGGTCCTCGT
AGAGGAACGCTGGAATTTTTGGCCCGCCCTTCCTCGCTTGCGGCTCAATCGGGCAGCACAAACGCCAATAATGCT
CGAAATTCCACGCCCGAGTCTGATGCTGGAGGACTGTCGCCGGTTTTTGAGGAGCGCAAATATGCGTTCAAGTTT
GTATTGGGTTGGCTTCAGCAGCCCATGCCGGCTACAGGGCGTGATCTTACGCGTCCTCGACTTCCGGCTGCAGCT
CATTCGCAAGTCATTGCTAGAGGAGGGAGGCGCTCGTCTTATGCCTCCCAGACCCGCGGACGACTAGCCAAGGAG
GAGGTTGACGAGCCAGCGGAAAAGGAGCGAAGAGGTTTGGTGAATGCTACTGTAGAGGAGTGGCTTCGCGGCACC
TCACTTGCAGCAATGCACCCCGGTGAAGGGAAAACAAAGTCGAACCCGGACGGCAGAAGAAGCAGCGTTTCAGCA
GAGGCACCAATTCGACCTCGAATGGCTCCTTGGCGGGGGAGCCAGGACACGAGCCGGGATCTCTTGGTCAGGGCA
GTCAAACCCCAAGGGATATTTGCCAGTAACTCGGTCTACTTGGGCCGAGCTTTGGCTGAATGGGCTCTTGTAGTT
TCAGAGTGTAATAACTTTGTGGATCGGCGCTGCGAAGAGGGTGTTGCACGCCCCAACGAGGTCGAGGTTCCACAT
CTCGGAGTGGAGGGATTCCGCAAGTTGGGCGTCTAG
Gene >OphauG2|6478
ATGACGGCCTCGGCCGTACAACAGCCACCGCGCTTCTTCCCTCGATCGCACTCGACCCCCGACTTGTTGTCCCGG
GGCCCCTCGACAAATTCCAACCAAGATGGAGACTGGAACACCTGGTCCGAGCCCGCCTTTGAGGTGCCCTCTTTC
AACTCGGATTTTGAGCTCGACACGTCCCTCTTGACCAATTCCCGCCCAGTCACGCGCCCCCATGAGGACCAAGCT
GCCTTCGACTCCCCACGCAAACCATCGCTGGCCCGCTCCAAGGCTGCCTCGTTTCTCGATCGCCAACGCTCGTGG
CTGCTTTCCACCTCGCGCCCAACCAAGGATGCTGCAAACAATGAGCCCCACGACGGGGCCGACAATGGCGGCGCT
TCGAGACGTGACGTAGCTCATGCACGATTATCGGAGCGAGGCGCCACGCATTCCTCGAGCGGCTCATTGGCCAAC
TTTGCCTCCAAATGGTCCTGGTCCACCACGTCTCTATCCTCCCTCAAGGCTACGTCAGAATCATCAGGCAGCAAG
CCGCTTCTCAGGGCTGCCACCACCAGACATGCCAAGGCGTCACCAAAAAGCAGCCAATCCGTGTCAGATGCTCCC
AAGGCAAAGTCCGCGGACCAAGGCCGCACAGGCACACATTCACCAACACCGCCATTGGGTCCTCTGGCCCGCTCG
GGTTCCTACTTGTCCAAGGCGAGGCAAAAGCCTCCTGTGCTCGTGTCGAGGGGCAATGATGGTAGCCTGGACTCG
GATATGAGCTGTGCATCATCGTCGACAAGCCTTGCCAATCGCCGTTCTAGCGACAAGACAAGCACAACGCAATCC
ATGTGCAGCGATGGCAACACAAATACACCAATGACGGATGAATATTCAAATGACGCAATGCCCTCCACTATTGCC
CTGCGTGACCCTCTGTGGTCGTCGTTTCAGAATCTCGACGTCGACTTTAAAAACTTTGGCTCAAAACAGACATCA
TCACGCATCAGTCAAGTCAAGAATACTCTGGTGCCTTTTTTGCGAAACACGGGCGATTCCAAATTGATCAAGCGA
TTGAGTCTCGAGGACATTGAGCGAAGAAGCACCATTCTGAACAAGTGGTGGGGCGCTATTCTCGACATGCTTCAA
GATCGAGGCCAACACCCTGTTCCCGGAATCGAGCGCCCCGTTTTACTCGAGGCGGCCACGCTGCTCATGATGAGG
ACGGAATGGCGCCAGGCGACCAGCCATTTCCAACCGCTTGTCGATCGCTCCCCAAACGAACGTGTTCAGGCCAAG
TGTCAAAGCAAAGACTTTCATTCCATTCAAGACGCGGCTCACGACACCTTGCTAGCCGACTCGGCCGAGCACAAC
GTGCGCACCATGTTTGTCATGAATCTACTCAAGCAAATGGCCTATGTTGTGGACAGAATGTCTGTGCGCCATGCG
CCTCTTAGCCTGGTCAATTTCTCGGGCAAGGCCTGCGCCTACGCCTTCTTCTTCGCCCCAGGCGTAGCCGATATT
CTTGTCCGATTGTGGGGCTTAACACCGGAGCTCATTCGCCGCGCCGCTGAAGCTCTTGGCCTCCCGAGGGTGGAT
GGTGGTGAAAGCGACGACATTGCCGCTCTTTTCCCCCACAACCTGGGCGCTTTTGGCTGGACTTCCTCACGAACT
ATATGGGATCAGCTCAAAAAGGTGCCCAAAATGTCTCTGCTCGTTGCCCGCATCCCGTGGACGGGCCCTTGGGTC
TCACGGTGGAAGGGCCGAGACACGGACCTATTCTTCATCTTTTGCAAGTATTTTCATGTTCTAGCGGATCAATTT
ATTCCCCAGGGACTGCCCATTCTGGAAAAGGCTCGTTCGCCCGCCTTTGTTGTGCTCCATGCTCAACTACTCTCC
ATACTTGACACCACTATTCACCGTCAGATGGCCATGGAGCACGGATCCGCCTCCCCTCCCTTGATCGACTCGGTC
AATGGAGCAGACGCCTCGGCTCTAGCCCTACCGCTGCCCCCCACAAATCTGATGAAGGGCATGGCTGAGAATAGG
CTGGTGGTGCTACTCAAGGACTTGCTTTCCGATGACGCTGCTGAGATGCTCGGAGCTCGGCGTACCTTTGCCGAG
GCTTTTGCCTGCCTGCTCAAGGGTGCTACATGCAAAACATCGCAGTTCAATAGCACCGCATGTTTTACGCTTTGT
GATTTTGTCGAAGAGGCCATTAATGTCTACCAAGAATTTGAGACTGAAGATGCGTCGACGCGCCATGTCGATTGG
GAGTTTTGGCTCCAGGTGTGCAAGCGCATCATGCAATCATTGAACACCATGTCTGAGGTGCGCACGCTGTCTTTT
ATATATGCCATTTGGGATGCAGTGGCCAGGGATCCACAACGAAAGGAAACGCTTTGCCTCGACTGGCTGCTCACT
GAACAAACATTTAATGCCTTGTTCAACCACTGGTGCCCCATGGTCCGAGCCTACTACCAGCGTCTTCTCTGTTGG
AGAATCTGCCGCGATGATGGGAGTGGCAGCGAGCTGGACTTGTAAGTCGCAGCACCTATGCAGATATACATACAA
TTACCGACTTGCTGACATGAGACGCAGAGAAATCATGATGGTGGCATCGGCGAGACTGCGGACTGCATGGTCACA
TTACCTATATCTGAAGCGAAGCGCAGAAGACGCTGGGCGAGCCGGTCCGTCGACGGCGCCTACTTGCCCGGCTCT
TGGCAAAAGATTTATGATTATCCGTCACGAGGTTAATGCCCCTCAACCAGGATTGTTTGTTGGCTTTGATAGCTT
TGCTCGGATAACGAGCAGCGATGGACTGTTGGTCAACAGCCTCTGTGATGGCAGTCAAAATGGTAAAGGAGACTC
CAAGAAGCGCTGGTCCTTGTTGGGCAAAGTCCTTTCCATGACTGGGAGCAATACTGGCGGCACTGGTCCATCATC
GCCGAGCTTGGACGTGCCTGCGCGAGGCCATTTTACGGAATATGATCTCATTGGTCCTCGTAGAGGAACGCTGGA
ATTTTTGGCCCGCCCTTCCTCGCTTGCGGCTCAATCGGGCAGCACAAACGCCAATAATGCTCGAAATTCCACGCC
CGAGTCTGATGCTGGAGGACTGTCGCCGGTTTTTGAGGAGCGCAAATATGCGTTCAAGTTTGTATTGGGTTGGCT
TCAGCAGCCCATGCCGGCTACAGGGCGTGATCTTACGCGTCCTCGACTTCCGGCTGCAGCTCATTCGCAAGTCAT
TGCTAGAGGAGGGAGGCGCTCGTCTTATGCCTCCCAGACCCGCGGACGACTAGCCAAGGAGGAGGTTGACGAGCC
AGCGGAAAAGGAGCGAAGAGGTTTGGTGAATGCTACTGTAGAGGAGTGGCTTCGCGGCACCTCACTTGCAGCAAT
GCACCCCGGTGAAGGGAAAACAAAGTCGAACCCGGACGGCAGAAGAAGCAGCGTTTCAGCAGAGGCACCAATTCG
ACCTCGAATGGCTCCTTGGCGGGGGAGCCAGGACACGAGCCGGGATCTCTTGGTCAGGGCAGTCAAACCCCAAGG
GATATTTGCCAGTAACTCGGTCTACTTGGGCCGAGCTTTGGCTGAATGGGCTCTTGTAGTTTCAGAGTGTAATAA
CTTTGTGGATCGGCGCTGCGAAGAGGGTGTTGCACGCCCCAACGAGGTCGAGGTTCCACATCTCGGAGTGGAGGG
ATTCCGCAAGTTGGGCGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail