Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6474
Gene name
LocationContig_67:28552..30418
Strand+
Gene length (bp)1866
Transcript length (bp)1461
Coding sequence length (bp)1461
Protein length (aa) 487

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00651 BTB BTB/POZ domain 7.6E-05 145 223
PF00651 BTB BTB/POZ domain 5.4E-10 307 409
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.0E-07 41 122
PF13637 Ank_4 Ankyrin repeats (many copies) 1.6E-05 42 88

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10225|BTB3_SCHPO BTB/POZ domain-containing protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=btb3 PE=1 SV=1 30 476 5.0E-63
sp|P40560|YIA1_YEAST Ankyrin repeat-containing protein YIL001W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL001W PE=1 SV=1 36 462 5.0E-52
sp|Q99LJ2|ABTB1_MOUSE Ankyrin repeat and BTB/POZ domain-containing protein 1 OS=Mus musculus GN=Abtb1 PE=2 SV=1 38 466 7.0E-27
sp|Q5XIU1|ABTB1_RAT Ankyrin repeat and BTB/POZ domain-containing protein 1 OS=Rattus norvegicus GN=Abtb1 PE=2 SV=1 38 466 8.0E-27
sp|Q969K4|ABTB1_HUMAN Ankyrin repeat and BTB/POZ domain-containing protein 1 OS=Homo sapiens GN=ABTB1 PE=1 SV=1 38 466 5.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10225|BTB3_SCHPO BTB/POZ domain-containing protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=btb3 PE=1 SV=1 30 476 5.0E-63
sp|P40560|YIA1_YEAST Ankyrin repeat-containing protein YIL001W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL001W PE=1 SV=1 36 462 5.0E-52
sp|Q99LJ2|ABTB1_MOUSE Ankyrin repeat and BTB/POZ domain-containing protein 1 OS=Mus musculus GN=Abtb1 PE=2 SV=1 38 466 7.0E-27
sp|Q5XIU1|ABTB1_RAT Ankyrin repeat and BTB/POZ domain-containing protein 1 OS=Rattus norvegicus GN=Abtb1 PE=2 SV=1 38 466 8.0E-27
sp|Q969K4|ABTB1_HUMAN Ankyrin repeat and BTB/POZ domain-containing protein 1 OS=Homo sapiens GN=ABTB1 PE=1 SV=1 38 466 5.0E-24
sp|Q9SJ85|Y2474_ARATH BTB/POZ domain-containing protein At2g04740 OS=Arabidopsis thaliana GN=At2g04740 PE=2 SV=2 28 466 2.0E-17
sp|Q6UB98|ANR12_HUMAN Ankyrin repeat domain-containing protein 12 OS=Homo sapiens GN=ANKRD12 PE=1 SV=3 2 92 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6474
MPLDEYEPGTRLGQDERLINKGVLRDETPLDQSPEFDEFLLACRKGDLRKCQQLISLGVNINGKDKFDYTPLIIA
SLCGHYELVRLLLESGALAERNTFQGERCIYNALNNRIRNLLLEYDFSKSSDPLVYWSGHISSLLARTTPATWDI
EVTTGESTIKAHRFILAARTRFFARFLAHDASAAVWRGEALGVPARALHLALRHVYLDDLPRELVPAGSSGDEEE
TMVAGLDKVSRQLGIEQLGEAVLAARQHGRLARQRFQDEEARALRDVRDFFQRHVLGNKMEVETARVDEVCWGRD
NAAFADVLLCADSTPDDAASATSTLFPAHKAMLIRSPYFATMFSGPFIEARPSARLAIITMDCSAPVVQLVLTHL
YTESIPSPPLHHALDLVYAADMLLLDALKTRAAAAIATLGTPAQDAADDDEQINVYDVLHAAWDLGIPRLEEFAA
RYIAARLELYIDDAAFHDAVRARLGRRAKCHGTKCH*
Coding >OphauG2|6474
ATGCCTCTCGACGAGTACGAGCCAGGAACAAGACTGGGCCAAGACGAGCGTCTCATCAACAAGGGCGTTTTACGC
GATGAAACCCCTCTCGACCAGAGCCCCGAGTTTGACGAGTTTCTACTCGCGTGCCGCAAGGGAGACTTGCGCAAG
TGTCAGCAACTCATCAGCCTAGGCGTCAACATCAACGGCAAGGACAAGTTTGACTATACGCCCCTGATTATTGCA
AGCTTGTGCGGGCACTACGAGCTGGTGCGTCTGCTTCTCGAGTCTGGCGCGCTGGCGGAGCGAAACACGTTTCAG
GGCGAGCGCTGCATTTACAATGCCCTCAACAACCGCATCCGGAACCTTCTTCTCGAATACGACTTTTCCAAATCC
TCGGATCCGCTGGTTTACTGGTCTGGACATATTTCCAGCCTGTTGGCGCGCACGACACCAGCAACATGGGACATT
GAAGTAACGACGGGGGAATCGACCATCAAGGCGCATCGGTTTATACTCGCGGCGCGGACACGGTTCTTTGCTCGG
TTTTTGGCACACGATGCAAGCGCGGCCGTGTGGCGTGGCGAGGCGCTGGGCGTGCCGGCGCGGGCGCTGCACCTC
GCGCTGCGGCATGTTTACCTGGACGACTTGCCGCGCGAGCTGGTGCCGGCGGGCAGCTCGGGCGACGAGGAGGAG
ACAATGGTGGCAGGGCTGGACAAGGTGAGTAGACAGCTGGGGATTGAGCAGCTGGGGGAGGCGGTGCTGGCGGCG
CGGCAGCACGGGCGGTTGGCGAGGCAGCGCTTCCAGGACGAGGAGGCGAGGGCGCTGCGTGACGTGCGGGATTTT
TTCCAGCGCCATGTGCTGGGGAATAAGATGGAGGTTGAGACGGCGCGCGTTGACGAGGTGTGCTGGGGGCGCGAC
AATGCTGCCTTTGCAGACGTGCTGCTGTGCGCCGACTCTACTCCTGACGACGCAGCCAGCGCCACGTCGACGCTC
TTTCCCGCGCACAAAGCCATGCTCATCCGCAGCCCGTACTTTGCCACCATGTTCTCGGGCCCGTTTATCGAAGCC
CGCCCGTCGGCCCGTCTCGCCATCATCACCATGGACTGCTCCGCGCCCGTTGTCCAACTCGTCCTCACCCATCTC
TACACCGAATCCATACCCTCCCCGCCGCTCCACCACGCCCTCGACCTCGTCTACGCTGCAGACATGCTGCTCCTC
GACGCGTTGAAAACTCGAGCCGCCGCTGCAATCGCCACGCTCGGCACCCCCGCCCAAGACGCCGCCGACGACGAC
GAGCAGATTAATGTCTACGACGTGCTGCACGCCGCCTGGGACTTGGGCATCCCGCGGCTTGAGGAGTTTGCTGCG
CGGTACATTGCCGCCCGGCTCGAGCTGTATATCGATGACGCGGCGTTTCATGACGCCGTGCGCGCACGTCTTGGC
CGCCGCGCAAAATGCCACGGCACAAAATGCCACTAG
Transcript >OphauG2|6474
ATGCCTCTCGACGAGTACGAGCCAGGAACAAGACTGGGCCAAGACGAGCGTCTCATCAACAAGGGCGTTTTACGC
GATGAAACCCCTCTCGACCAGAGCCCCGAGTTTGACGAGTTTCTACTCGCGTGCCGCAAGGGAGACTTGCGCAAG
TGTCAGCAACTCATCAGCCTAGGCGTCAACATCAACGGCAAGGACAAGTTTGACTATACGCCCCTGATTATTGCA
AGCTTGTGCGGGCACTACGAGCTGGTGCGTCTGCTTCTCGAGTCTGGCGCGCTGGCGGAGCGAAACACGTTTCAG
GGCGAGCGCTGCATTTACAATGCCCTCAACAACCGCATCCGGAACCTTCTTCTCGAATACGACTTTTCCAAATCC
TCGGATCCGCTGGTTTACTGGTCTGGACATATTTCCAGCCTGTTGGCGCGCACGACACCAGCAACATGGGACATT
GAAGTAACGACGGGGGAATCGACCATCAAGGCGCATCGGTTTATACTCGCGGCGCGGACACGGTTCTTTGCTCGG
TTTTTGGCACACGATGCAAGCGCGGCCGTGTGGCGTGGCGAGGCGCTGGGCGTGCCGGCGCGGGCGCTGCACCTC
GCGCTGCGGCATGTTTACCTGGACGACTTGCCGCGCGAGCTGGTGCCGGCGGGCAGCTCGGGCGACGAGGAGGAG
ACAATGGTGGCAGGGCTGGACAAGGTGAGTAGACAGCTGGGGATTGAGCAGCTGGGGGAGGCGGTGCTGGCGGCG
CGGCAGCACGGGCGGTTGGCGAGGCAGCGCTTCCAGGACGAGGAGGCGAGGGCGCTGCGTGACGTGCGGGATTTT
TTCCAGCGCCATGTGCTGGGGAATAAGATGGAGGTTGAGACGGCGCGCGTTGACGAGGTGTGCTGGGGGCGCGAC
AATGCTGCCTTTGCAGACGTGCTGCTGTGCGCCGACTCTACTCCTGACGACGCAGCCAGCGCCACGTCGACGCTC
TTTCCCGCGCACAAAGCCATGCTCATCCGCAGCCCGTACTTTGCCACCATGTTCTCGGGCCCGTTTATCGAAGCC
CGCCCGTCGGCCCGTCTCGCCATCATCACCATGGACTGCTCCGCGCCCGTTGTCCAACTCGTCCTCACCCATCTC
TACACCGAATCCATACCCTCCCCGCCGCTCCACCACGCCCTCGACCTCGTCTACGCTGCAGACATGCTGCTCCTC
GACGCGTTGAAAACTCGAGCCGCCGCTGCAATCGCCACGCTCGGCACCCCCGCCCAAGACGCCGCCGACGACGAC
GAGCAGATTAATGTCTACGACGTGCTGCACGCCGCCTGGGACTTGGGCATCCCGCGGCTTGAGGAGTTTGCTGCG
CGGTACATTGCCGCCCGGCTCGAGCTGTATATCGATGACGCGGCGTTTCATGACGCCGTGCGCGCACGTCTTGGC
CGCCGCGCAAAATGCCACGGCACAAAATGCCACTAG
Gene >OphauG2|6474
ATGCCTCTCGACGAGTACGAGCCAGGAACAAGACTGGGCCAAGACGAGCGTCTCATCAACAAGGGCGTTTTACGC
GATGAAACCCCTCTCGACCAGAGCCCCGAGTTTGACGAGTTTCTACTCGCGTGCCGCAAGGGAGACTTGCGCAAG
TGTCAGCAACTCATCAGCCTAGGCGTCAACATCAACGGCAAGGACAAGTTTGACTATACGCCCCTGATTATTGTA
AGCTTTTGGAGGTTGGAATGGGTGGGGGAGAGGAGGGGATTGTTGCTGACTTTTTGAGGCGCGGGGGTGCTTGTA
GGCAAGCTTGTGCGGGCACTACGAGCTGGTGCGTCTGCTTCTCGAGTCTGGTATGGTAAAGCATGAAGCGCACGT
GAAGTAGAAGAAGAAGGAGAAGGAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAAAAAAAAAAGCT
CTATCAAGGTGCAGTAAACGGGCTCACTGCTTGCAGGCGCGCTGGCGGAGCGAAACACGTTTCAGGGCGAGCGCT
GCATTTACAATGCCCTCAACAACCGCATCCGGAACCTTCTTCTCGAATACGACTTTTCCAAATCCTCGGATCCGC
TGGTTTACTGGTCTGGACATATTTCCAGCCTGTTGGCGCGCACGACACCAGCAACATGGGACATTGAAGTAACGA
CGGGGGAATCGACCATCAAGGCGCATCGGTTTATACTCGCGGCGCGGACACGGTTCTTTGCTCGGTTTTTGGCAC
ACGATGCAAGCGCGGCCGTGTGGCGTGGCGAGGCGCTGGGCGTGCCGGCGCGGGCGCTGCACCTCGCGCTGCGGC
ATGTTTACCTGGACGACTTGCCGCGCGAGCTGGTGCCGGCGGGCAGCTCGGGCGACGAGGAGGAGACAATGGTGG
CAGGGCTGGACAAGGTGAGTAGACAGCTGGGGATTGAGCAGCTGGGGGAGGCGGTGCTGGCGGCGCGGCAGCACG
GGCGGTTGGCGAGGCAGCGCTTCCAGGACGAGGAGGCGAGGGCGCTGCGTGACGTGCGGGATTTTTTCCAGCGCC
ATGTGCTGGGGAATAAGATGGAGGTTGAGACGGCGCGCGTTGACGAGGTGTGCTGGGGGCGCGACAATGCTGCCT
TTGCAGACGTGCTGCTGTGCGCCGACTCTACTCCTGGTGCGTCATGCTGCCCCCTCTCCCCCTTTTTTTTCCTTG
TTCTTTTCCATGGTGGTAATTCTCTCTCTCTCCAGACGACGCAGCCAGCGCCACGTCGACGCTCTTTCCCGCGCA
CAAAGCCATGCTCATCCGCAGCCCGTACTTTGCCACCATGTTCTCGGGCCCGTTTATCGAAGCCCGCCCGTCGGC
CCGTCTCGCCATCATCACCATGGACTGCTCCGCGCCCGTTGTCCAACTCGTCCTCACCCATCTCTACACCGAATC
CATACCCTCCCCGCCGCTCCACCACGCCCTCGACCTCGTCTACGCTGCAGACATGCTGCTCCTCGACGCGTTGAA
AACTCGAGCCGCCGCTGCAATCGCCACGCTCGGCACCCCCGCCCAAGACGCCGCCGACGACGACGAGCAGATTAA
TGTCTACGACGTGCTGCACGCCGCCTGGGACTTGGGCATCCCGCGGCTTGAGGAGTTTGCTGCGCGGTACATTGC
CGCCCGGCTCGAGCTGTATATCGATGACGCGGCGTTTCATGACGCCGTGCGCGCGTCGGCCGCCAGGATTCGGCA
CAGGCAGGATACCGACTCGATTGAGCTGGTGGACGATGTGCGCTACTATCTCTCGGAGCGCTTTCGCCTGCGCTT
TGAGGACACGGGGCTTCCAGACGTCTTGGCCGCCGCGCAAAATGCCACGGCACAAAATGCCACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail