Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6450
Gene name
LocationContig_666:6234..7054
Strand+
Gene length (bp)820
Transcript length (bp)765
Coding sequence length (bp)765
Protein length (aa) 255

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family 4.6E-21 114 206

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P29453|RL8B_YEAST 60S ribosomal protein L8-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL8B PE=1 SV=3 17 251 3.0E-122
sp|P17076|RL8A_YEAST 60S ribosomal protein L8-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL8A PE=1 SV=4 18 251 2.0E-120
sp|O13672|RL8_SCHPO 60S ribosomal protein L8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl8 PE=1 SV=3 10 238 3.0E-120
sp|Q2TBQ5|RL7A_BOVIN 60S ribosomal protein L7a OS=Bos taurus GN=RPL7A PE=2 SV=3 19 254 2.0E-96
sp|P35685|RL7A_ORYSJ 60S ribosomal protein L7a OS=Oryza sativa subsp. japonica GN=RPL7A PE=2 SV=1 19 254 3.0E-96
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P29453|RL8B_YEAST 60S ribosomal protein L8-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL8B PE=1 SV=3 17 251 3.0E-122
sp|P17076|RL8A_YEAST 60S ribosomal protein L8-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL8A PE=1 SV=4 18 251 2.0E-120
sp|O13672|RL8_SCHPO 60S ribosomal protein L8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl8 PE=1 SV=3 10 238 3.0E-120
sp|Q2TBQ5|RL7A_BOVIN 60S ribosomal protein L7a OS=Bos taurus GN=RPL7A PE=2 SV=3 19 254 2.0E-96
sp|P35685|RL7A_ORYSJ 60S ribosomal protein L7a OS=Oryza sativa subsp. japonica GN=RPL7A PE=2 SV=1 19 254 3.0E-96
sp|P62425|RL7A_RAT 60S ribosomal protein L7a OS=Rattus norvegicus GN=Rpl7a PE=1 SV=2 19 254 1.0E-95
sp|Q4R5C2|RL7A_MACFA 60S ribosomal protein L7a OS=Macaca fascicularis GN=RPL7A PE=2 SV=1 19 254 1.0E-95
sp|P62424|RL7A_HUMAN 60S ribosomal protein L7a OS=Homo sapiens GN=RPL7A PE=1 SV=2 19 254 1.0E-95
sp|P12970|RL7A_MOUSE 60S ribosomal protein L7a OS=Mus musculus GN=Rpl7a PE=1 SV=2 19 254 1.0E-95
sp|O57592|RL7A_TAKRU 60S ribosomal protein L7a OS=Takifugu rubripes GN=rpl7a PE=3 SV=3 19 254 2.0E-95
sp|Q9LZH9|RL7A2_ARATH 60S ribosomal protein L7a-2 OS=Arabidopsis thaliana GN=RPL7AB PE=1 SV=1 19 254 4.0E-95
sp|P49692|RL7A1_ARATH 60S ribosomal protein L7a-1 OS=Arabidopsis thaliana GN=RPL7AA PE=1 SV=2 19 254 6.0E-95
sp|P32429|RL7A_CHICK 60S ribosomal protein L7a OS=Gallus gallus GN=RPL7A PE=2 SV=2 19 254 1.0E-94
sp|Q90YW2|RL7A_ICTPU 60S ribosomal protein L7a OS=Ictalurus punctatus GN=rpl7a PE=2 SV=3 19 254 1.0E-92
sp|P46223|RL7A_DROME 60S ribosomal protein L7a OS=Drosophila melanogaster GN=RpL7A PE=1 SV=2 19 253 4.0E-87
sp|Q966C6|RL7A_CAEEL 60S ribosomal protein L7a OS=Caenorhabditis elegans GN=rpl-7A PE=1 SV=3 18 247 7.0E-87
sp|P0DJ14|RL7A_TETTH 60S ribosomal protein L7a OS=Tetrahymena thermophila GN=RPL7A PE=1 SV=1 19 249 3.0E-83
sp|O76732|RL7A_ANOGA 60S ribosomal protein L7a OS=Anopheles gambiae GN=RpL7A PE=3 SV=2 19 247 2.0E-80
sp|Q54ZD1|RL7A_DICDI 60S ribosomal protein L7a OS=Dictyostelium discoideum GN=rpl7a PE=1 SV=1 19 247 6.0E-68
sp|Q29375|RL7A_PIG 60S ribosomal protein L7a (Fragment) OS=Sus scrofa GN=RPL7A PE=2 SV=1 81 212 3.0E-43
sp|Q8SSG1|RL7A_ENCCU 60S ribosomal protein L7a OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPL7A PE=1 SV=2 60 230 3.0E-37
sp|Q9HJ56|RL7A_THEAC 50S ribosomal protein L7Ae OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpl7ae PE=3 SV=1 127 197 2.0E-10
sp|Q97BK8|RL7A_THEVO 50S ribosomal protein L7Ae OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rpl7ae PE=3 SV=1 127 197 4.0E-10
sp|Q6KZI7|RL7A_PICTO 50S ribosomal protein L7Ae OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rpl7ae PE=3 SV=1 127 216 1.0E-09
sp|A2BK92|RL7A_HYPBU 50S ribosomal protein L7Ae OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rpl7ae PE=3 SV=1 119 215 2.0E-09
sp|P54066|RL7A_METJA 50S ribosomal protein L7Ae OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpl7ae PE=1 SV=2 119 213 1.0E-08
sp|B1Y9V4|RL7A_PYRNV 50S ribosomal protein L7Ae OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rpl7ae PE=3 SV=1 119 215 2.0E-08
sp|Q8TV03|RL7A_METKA 50S ribosomal protein L7Ae OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rpl7ae PE=3 SV=1 127 182 2.0E-08
sp|O29494|RL7A_ARCFU 50S ribosomal protein L7Ae OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rpl7ae PE=1 SV=1 127 214 6.0E-08
sp|Q8ZTA5|RL7A_PYRAE 50S ribosomal protein L7Ae OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rpl7ae PE=3 SV=1 127 215 7.0E-08
sp|P62427|RL7A_NANEQ 50S ribosomal protein L7Ae OS=Nanoarchaeum equitans (strain Kin4-M) GN=rpl7ae PE=3 SV=1 127 215 1.0E-07
sp|Q9YAX7|RL7A_AERPE 50S ribosomal protein L7Ae OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rpl7ae PE=1 SV=1 118 191 2.0E-07
sp|A6UT51|RL7A_META3 50S ribosomal protein L7Ae OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpl7ae PE=3 SV=1 115 197 3.0E-07
sp|A3DMR6|RL7A_STAMF 50S ribosomal protein L7Ae OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rpl7ae PE=3 SV=1 127 194 4.0E-07
sp|B8D6E8|RL7A_DESK1 50S ribosomal protein L7Ae OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=rpl7ae PE=3 SV=1 95 198 6.0E-07
sp|Q54ST0|NH2L1_DICDI NHP2-like protein 1 homolog OS=Dictyostelium discoideum GN=DDB_G0282243 PE=3 SV=1 127 217 6.0E-07
sp|Q5JGR3|RL7A_THEKO 50S ribosomal protein L7Ae OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpl7ae PE=3 SV=2 119 197 7.0E-07
sp|Q8U160|RL7A_PYRFU 50S ribosomal protein L7Ae OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpl7ae PE=1 SV=2 119 182 1.0E-06
sp|B6YWH9|RL7A_THEON 50S ribosomal protein L7Ae OS=Thermococcus onnurineus (strain NA1) GN=rpl7ae PE=3 SV=1 127 197 1.0E-06
sp|C5A1V9|RL7A_THEGJ 50S ribosomal protein L7Ae OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rpl7ae PE=3 SV=1 119 182 1.0E-06
sp|P62008|RL7A_PYRAB 50S ribosomal protein L7Ae OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpl7ae PE=1 SV=1 119 182 1.0E-06
sp|P62009|RL7A_PYRHO 50S ribosomal protein L7Ae OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpl7ae PE=1 SV=1 119 182 1.0E-06
sp|A3MTA9|RL7A_PYRCJ 50S ribosomal protein L7Ae OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rpl7ae PE=3 SV=1 127 215 2.0E-06
sp|A8A912|RL7A_IGNH4 50S ribosomal protein L7Ae OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rpl7ae PE=3 SV=1 127 182 4.0E-06
sp|Q4J8P1|RL7A_SULAC 50S ribosomal protein L7Ae OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpl7ae PE=3 SV=1 127 191 5.0E-06
sp|Q971C9|RL7A_SULTO 50S ribosomal protein L7Ae OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpl7ae PE=3 SV=1 121 215 5.0E-06
sp|P55858|RL7A_SULSO 50S ribosomal protein L7Ae OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpl7ae PE=1 SV=2 121 193 6.0E-06
sp|C3N8Q2|RL7A_SULIY 50S ribosomal protein L7Ae OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rpl7ae PE=3 SV=1 121 193 8.0E-06
sp|C3NMR6|RL7A_SULIN 50S ribosomal protein L7Ae OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rpl7ae PE=3 SV=1 121 193 8.0E-06
sp|C3MYY9|RL7A_SULIM 50S ribosomal protein L7Ae OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rpl7ae PE=3 SV=1 121 193 8.0E-06
sp|C3MJN1|RL7A_SULIL 50S ribosomal protein L7Ae OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rpl7ae PE=3 SV=1 121 193 8.0E-06
sp|C4KJ77|RL7A_SULIK 50S ribosomal protein L7Ae OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rpl7ae PE=3 SV=1 121 193 8.0E-06
sp|C3N038|RL7A_SULIA 50S ribosomal protein L7Ae OS=Sulfolobus islandicus (strain M.16.27) GN=rpl7ae PE=3 SV=1 121 193 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6450
MLCLIILVTRVAHVPLAQNPLIEKRPRNFGIGQDIQPKRNLSRMVKWPEYVRLQRQKKILQMRLKVPPALAQFQH
VVDRNTATQVFKLLNKYRPETKPEKKERLLKEATAIKEGKKKEDVSKKPYTVKYGLNHVVGLVENKKASLVLIPN
DVDPIELVVFLPSLCKKMGVPYAIIKGKARLGTVVHKKTAAVLALTEVRTEDKSELSKLISAVKDGFMEKHDQAR
KQWGGGIMGAKAQMRIMKRQKAIEAATKI*
Coding >OphauG2|6450
ATGTTGTGTCTCATCATTTTGGTCACCCGAGTTGCTCATGTCCCGCTCGCACAGAACCCGCTCATCGAGAAGCGT
CCCCGCAACTTTGGCATAGGCCAGGATATTCAGCCTAAACGAAACCTTTCCCGCATGGTCAAGTGGCCAGAGTAT
GTCCGCCTTCAGCGCCAAAAGAAGATTCTGCAGATGCGCCTCAAGGTTCCTCCTGCGCTTGCCCAGTTTCAGCAC
GTCGTGGACCGCAACACGGCTACCCAGGTCTTCAAGCTCCTCAACAAGTACCGCCCTGAGACAAAGCCCGAGAAG
AAGGAGCGTCTGTTGAAGGAGGCGACAGCCATCAAGGAGGGCAAGAAGAAGGAAGATGTCAGCAAGAAGCCTTAT
ACAGTCAAATATGGTCTCAACCACGTGGTGGGCTTGGTGGAGAACAAGAAGGCCTCGCTAGTCCTTATCCCCAAC
GATGTGGATCCCATTGAGCTCGTCGTCTTCTTGCCGTCTTTGTGCAAGAAGATGGGTGTGCCATATGCGATTATC
AAGGGCAAGGCCCGCCTGGGCACAGTGGTGCACAAGAAGACTGCTGCCGTCTTGGCCCTGACCGAGGTTCGAACT
GAGGACAAGAGTGAGCTGTCCAAGCTCATCTCTGCCGTCAAGGATGGGTTCATGGAGAAGCACGACCAGGCACGG
AAACAGTGGGGAGGCGGCATCATGGGTGCAAAGGCTCAGATGCGCATCATGAAGCGCCAAAAGGCAATCGAGGCT
GCCACCAAGATTTGA
Transcript >OphauG2|6450
ATGTTGTGTCTCATCATTTTGGTCACCCGAGTTGCTCATGTCCCGCTCGCACAGAACCCGCTCATCGAGAAGCGT
CCCCGCAACTTTGGCATAGGCCAGGATATTCAGCCTAAACGAAACCTTTCCCGCATGGTCAAGTGGCCAGAGTAT
GTCCGCCTTCAGCGCCAAAAGAAGATTCTGCAGATGCGCCTCAAGGTTCCTCCTGCGCTTGCCCAGTTTCAGCAC
GTCGTGGACCGCAACACGGCTACCCAGGTCTTCAAGCTCCTCAACAAGTACCGCCCTGAGACAAAGCCCGAGAAG
AAGGAGCGTCTGTTGAAGGAGGCGACAGCCATCAAGGAGGGCAAGAAGAAGGAAGATGTCAGCAAGAAGCCTTAT
ACAGTCAAATATGGTCTCAACCACGTGGTGGGCTTGGTGGAGAACAAGAAGGCCTCGCTAGTCCTTATCCCCAAC
GATGTGGATCCCATTGAGCTCGTCGTCTTCTTGCCGTCTTTGTGCAAGAAGATGGGTGTGCCATATGCGATTATC
AAGGGCAAGGCCCGCCTGGGCACAGTGGTGCACAAGAAGACTGCTGCCGTCTTGGCCCTGACCGAGGTTCGAACT
GAGGACAAGAGTGAGCTGTCCAAGCTCATCTCTGCCGTCAAGGATGGGTTCATGGAGAAGCACGACCAGGCACGG
AAACAGTGGGGAGGCGGCATCATGGGTGCAAAGGCTCAGATGCGCATCATGAAGCGCCAAAAGGCAATCGAGGCT
GCCACCAAGATTTGA
Gene >OphauG2|6450
ATGTTGTGTCTCATCATTTTGGTCACCCGAGTTGCTCATGTCCCGCTCGCACAGAACCCGCTCATCGAGAAGCGT
CCCCGCAACTTTGGCATAGGCCAGGATATTCAGCCTAAACGAAACCTTTCCCGCATGGTCAAGTGGCCAGAGTAT
GTCCGCCTTCAGCGCCAAAAGAAGATTCTGCAGATGCGCCTCAAGGTTCCTCCTGCGCTTGCCCAGTTTCAGCAC
GTCGTGGACCGCAACACGGCTACCCAGGTCTTCAAGCTCCTCAACAAGTACCGCCCTGAGACAAAGCCCGAGAAG
AAGGAGCGTCTGTTGAAGGAGGCGACAGCCATCAAGGAGGGCAAGAAGAAGGAAGATGTCAGCAAGAAGCCTTAT
ACAGTCAAATATGGTCTCAACCACGTGGTGGGCTTGGTGGAGAACAAGAAGGCCTCGCTAGTCCTTATCCCCAAC
GATGTGGATCCCATTGAGCTCGTCGTCTTCTTGCCGTCTTTGTGCAAGAAGATGGGTGTGCCATATGCGATTATC
AAGGGCAAGGCCCGCCTGGGCACAGTGGTGCACAAGAAGGTGATTACATGCCGCTGAATACATTGCGCGATGGCT
AGAAGCTAACGAGTTGCAGACTGCTGCCGTCTTGGCCCTGACCGAGGTTCGAACTGAGGACAAGAGTGAGCTGTC
CAAGCTCATCTCTGCCGTCAAGGATGGGTTCATGGAGAAGCACGACCAGGCACGGAAACAGTGGGGAGGCGGCAT
CATGGGTGCAAAGGCTCAGATGCGCATCATGAAGCGCCAAAAGGCAATCGAGGCTGCCACCAAGATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail