Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6438
Gene name
LocationContig_663:8497..10129
Strand+
Gene length (bp)1632
Transcript length (bp)1632
Coding sequence length (bp)1632
Protein length (aa) 544

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5332
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6438 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4241
Ophiocordyceps camponoti-floridani Ophcf2|04208
Ophiocordyceps camponoti-rufipedis Ophun1|2242
Ophiocordyceps kimflemingae Ophio5|8010
Ophiocordyceps subramaniannii Hirsu2|5046

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6438
MQSRGYSESAVSAERSEAAVADAREAEAARTKCLMRGKAPSRQELGECSTEEVFDALVKLRSKQSTRFFRDMDLH
GRIMQLVGELVRNRRQRPTPFIYECVMDAMADPQGSASGVRKLLDDMASLKLAPTVDLCEAALAALANHPDYMLR
GQVLDMMKDYWLPERPWAKQYVVLGMLRDGQYELAYSRLCKLLDEGVVVDGWVLDILIVVFGDLGFLDEMLVLVE
RRTQSAAGPDGANIQHYALDVCSQAFHHAGTVHAWAAVTKLAHLEPADGIVENVLATAARHGDTTLATRALDVLS
RRGKILTSHYEAVCDAFAQARDVAGLLRIGRIMKQNGVLFLRPSTRVLHAAMRGSAAMVVDADAALRKLEPDGKT
PRFMLAALLEAVAELRGSEAVLDLYAAMPRLCGADPDALLLHALMLHSHQPETRRRLAADYMAAIPADPRRPPQA
WNALIASLLAANHLDLAFRFAKHAISSALPARAALPDWVQTLVEKAAATEDDRIWPIVDQLGRVAGTQQKTDLHL
WLSRTRFARQSRLEGLPS*
Coding >OphauG2|6438
ATGCAGAGCCGTGGATATTCGGAGAGTGCAGTCAGCGCGGAGAGAAGCGAGGCAGCAGTGGCGGACGCAAGAGAG
GCAGAGGCGGCGAGGACAAAGTGCTTGATGCGAGGCAAAGCTCCGTCACGACAAGAGCTGGGCGAATGCAGCACA
GAAGAGGTTTTTGACGCGCTGGTGAAGCTCCGGAGCAAGCAGTCGACGCGGTTCTTTCGAGACATGGATCTCCAC
GGACGCATCATGCAGCTTGTTGGGGAGCTGGTGAGGAATCGGCGGCAGCGGCCGACGCCGTTTATATACGAGTGC
GTCATGGACGCCATGGCGGATCCGCAGGGCTCGGCGAGCGGGGTGCGCAAGCTGCTGGACGACATGGCGTCGCTC
AAGCTGGCGCCGACAGTGGACCTCTGCGAGGCGGCATTGGCGGCGCTGGCAAACCACCCCGACTACATGCTGCGG
GGCCAGGTGCTGGACATGATGAAGGACTACTGGCTTCCCGAGCGGCCGTGGGCCAAGCAGTACGTGGTGCTGGGG
ATGCTGCGGGACGGGCAGTACGAGCTCGCGTACTCGCGGCTGTGCAAGCTGCTGGACGAGGGCGTCGTGGTGGAC
GGGTGGGTGCTGGACATCTTGATTGTGGTGTTTGGCGACCTGGGCTTCCTCGACGAGATGCTCGTGCTGGTGGAG
CGGCGCACGCAGTCGGCGGCGGGGCCCGACGGCGCCAACATTCAGCACTACGCGCTCGACGTGTGCAGCCAGGCC
TTTCACCACGCCGGCACCGTGCACGCGTGGGCGGCCGTGACCAAGCTGGCGCACCTCGAGCCGGCCGACGGCATT
GTGGAAAACGTGCTGGCCACGGCGGCGCGCCACGGCGACACCACGCTGGCAACGCGCGCCCTCGACGTGCTCTCG
CGCCGCGGCAAGATCCTCACGTCGCACTACGAAGCCGTGTGCGACGCCTTTGCCCAAGCCAGGGACGTGGCCGGC
CTGCTCCGCATCGGGCGCATCATGAAGCAAAACGGCGTCCTCTTTCTTCGGCCCAGCACTCGCGTCCTGCACGCA
GCGATGCGCGGCAGCGCGGCCATGGTCGTCGACGCCGACGCGGCGCTGCGCAAGCTGGAGCCCGACGGCAAGACG
CCGCGCTTCATGCTGGCCGCCTTGCTCGAGGCCGTCGCCGAGCTGCGCGGCTCCGAGGCCGTGCTCGACCTGTAC
GCCGCCATGCCGCGCCTCTGCGGCGCCGACCCCGACGCCCTCCTGCTCCACGCCCTCATGCTCCACAGCCACCAG
CCCGAAACGCGCCGCCGCCTGGCCGCCGACTACATGGCCGCCATCCCCGCCGACCCCCGCCGCCCCCCGCAGGCC
TGGAACGCCCTCATCGCAAGCCTCCTTGCCGCAAACCACCTCGACCTGGCCTTTCGCTTTGCCAAACACGCCATT
TCCTCCGCCCTGCCCGCCCGCGCCGCCCTGCCCGACTGGGTCCAGACCCTGGTGGAAAAGGCGGCCGCTACCGAA
GACGACCGCATCTGGCCCATTGTCGACCAGCTCGGCCGCGTCGCTGGCACACAGCAAAAGACGGACCTGCATCTC
TGGCTGTCACGAACCCGCTTTGCGAGACAGTCGCGTCTCGAAGGGCTTCCCTCGTGA
Transcript >OphauG2|6438
ATGCAGAGCCGTGGATATTCGGAGAGTGCAGTCAGCGCGGAGAGAAGCGAGGCAGCAGTGGCGGACGCAAGAGAG
GCAGAGGCGGCGAGGACAAAGTGCTTGATGCGAGGCAAAGCTCCGTCACGACAAGAGCTGGGCGAATGCAGCACA
GAAGAGGTTTTTGACGCGCTGGTGAAGCTCCGGAGCAAGCAGTCGACGCGGTTCTTTCGAGACATGGATCTCCAC
GGACGCATCATGCAGCTTGTTGGGGAGCTGGTGAGGAATCGGCGGCAGCGGCCGACGCCGTTTATATACGAGTGC
GTCATGGACGCCATGGCGGATCCGCAGGGCTCGGCGAGCGGGGTGCGCAAGCTGCTGGACGACATGGCGTCGCTC
AAGCTGGCGCCGACAGTGGACCTCTGCGAGGCGGCATTGGCGGCGCTGGCAAACCACCCCGACTACATGCTGCGG
GGCCAGGTGCTGGACATGATGAAGGACTACTGGCTTCCCGAGCGGCCGTGGGCCAAGCAGTACGTGGTGCTGGGG
ATGCTGCGGGACGGGCAGTACGAGCTCGCGTACTCGCGGCTGTGCAAGCTGCTGGACGAGGGCGTCGTGGTGGAC
GGGTGGGTGCTGGACATCTTGATTGTGGTGTTTGGCGACCTGGGCTTCCTCGACGAGATGCTCGTGCTGGTGGAG
CGGCGCACGCAGTCGGCGGCGGGGCCCGACGGCGCCAACATTCAGCACTACGCGCTCGACGTGTGCAGCCAGGCC
TTTCACCACGCCGGCACCGTGCACGCGTGGGCGGCCGTGACCAAGCTGGCGCACCTCGAGCCGGCCGACGGCATT
GTGGAAAACGTGCTGGCCACGGCGGCGCGCCACGGCGACACCACGCTGGCAACGCGCGCCCTCGACGTGCTCTCG
CGCCGCGGCAAGATCCTCACGTCGCACTACGAAGCCGTGTGCGACGCCTTTGCCCAAGCCAGGGACGTGGCCGGC
CTGCTCCGCATCGGGCGCATCATGAAGCAAAACGGCGTCCTCTTTCTTCGGCCCAGCACTCGCGTCCTGCACGCA
GCGATGCGCGGCAGCGCGGCCATGGTCGTCGACGCCGACGCGGCGCTGCGCAAGCTGGAGCCCGACGGCAAGACG
CCGCGCTTCATGCTGGCCGCCTTGCTCGAGGCCGTCGCCGAGCTGCGCGGCTCCGAGGCCGTGCTCGACCTGTAC
GCCGCCATGCCGCGCCTCTGCGGCGCCGACCCCGACGCCCTCCTGCTCCACGCCCTCATGCTCCACAGCCACCAG
CCCGAAACGCGCCGCCGCCTGGCCGCCGACTACATGGCCGCCATCCCCGCCGACCCCCGCCGCCCCCCGCAGGCC
TGGAACGCCCTCATCGCAAGCCTCCTTGCCGCAAACCACCTCGACCTGGCCTTTCGCTTTGCCAAACACGCCATT
TCCTCCGCCCTGCCCGCCCGCGCCGCCCTGCCCGACTGGGTCCAGACCCTGGTGGAAAAGGCGGCCGCTACCGAA
GACGACCGCATCTGGCCCATTGTCGACCAGCTCGGCCGCGTCGCTGGCACACAGCAAAAGACGGACCTGCATCTC
TGGCTGTCACGAACCCGCTTTGCGAGACAGTCGCGTCTCGAAGGGCTTCCCTCGTGA
Gene >OphauG2|6438
ATGCAGAGCCGTGGATATTCGGAGAGTGCAGTCAGCGCGGAGAGAAGCGAGGCAGCAGTGGCGGACGCAAGAGAG
GCAGAGGCGGCGAGGACAAAGTGCTTGATGCGAGGCAAAGCTCCGTCACGACAAGAGCTGGGCGAATGCAGCACA
GAAGAGGTTTTTGACGCGCTGGTGAAGCTCCGGAGCAAGCAGTCGACGCGGTTCTTTCGAGACATGGATCTCCAC
GGACGCATCATGCAGCTTGTTGGGGAGCTGGTGAGGAATCGGCGGCAGCGGCCGACGCCGTTTATATACGAGTGC
GTCATGGACGCCATGGCGGATCCGCAGGGCTCGGCGAGCGGGGTGCGCAAGCTGCTGGACGACATGGCGTCGCTC
AAGCTGGCGCCGACAGTGGACCTCTGCGAGGCGGCATTGGCGGCGCTGGCAAACCACCCCGACTACATGCTGCGG
GGCCAGGTGCTGGACATGATGAAGGACTACTGGCTTCCCGAGCGGCCGTGGGCCAAGCAGTACGTGGTGCTGGGG
ATGCTGCGGGACGGGCAGTACGAGCTCGCGTACTCGCGGCTGTGCAAGCTGCTGGACGAGGGCGTCGTGGTGGAC
GGGTGGGTGCTGGACATCTTGATTGTGGTGTTTGGCGACCTGGGCTTCCTCGACGAGATGCTCGTGCTGGTGGAG
CGGCGCACGCAGTCGGCGGCGGGGCCCGACGGCGCCAACATTCAGCACTACGCGCTCGACGTGTGCAGCCAGGCC
TTTCACCACGCCGGCACCGTGCACGCGTGGGCGGCCGTGACCAAGCTGGCGCACCTCGAGCCGGCCGACGGCATT
GTGGAAAACGTGCTGGCCACGGCGGCGCGCCACGGCGACACCACGCTGGCAACGCGCGCCCTCGACGTGCTCTCG
CGCCGCGGCAAGATCCTCACGTCGCACTACGAAGCCGTGTGCGACGCCTTTGCCCAAGCCAGGGACGTGGCCGGC
CTGCTCCGCATCGGGCGCATCATGAAGCAAAACGGCGTCCTCTTTCTTCGGCCCAGCACTCGCGTCCTGCACGCA
GCGATGCGCGGCAGCGCGGCCATGGTCGTCGACGCCGACGCGGCGCTGCGCAAGCTGGAGCCCGACGGCAAGACG
CCGCGCTTCATGCTGGCCGCCTTGCTCGAGGCCGTCGCCGAGCTGCGCGGCTCCGAGGCCGTGCTCGACCTGTAC
GCCGCCATGCCGCGCCTCTGCGGCGCCGACCCCGACGCCCTCCTGCTCCACGCCCTCATGCTCCACAGCCACCAG
CCCGAAACGCGCCGCCGCCTGGCCGCCGACTACATGGCCGCCATCCCCGCCGACCCCCGCCGCCCCCCGCAGGCC
TGGAACGCCCTCATCGCAAGCCTCCTTGCCGCAAACCACCTCGACCTGGCCTTTCGCTTTGCCAAACACGCCATT
TCCTCCGCCCTGCCCGCCCGCGCCGCCCTGCCCGACTGGGTCCAGACCCTGGTGGAAAAGGCGGCCGCTACCGAA
GACGACCGCATCTGGCCCATTGTCGACCAGCTCGGCCGCGTCGCTGGCACACAGCAAAAGACGGACCTGCATCTC
TGGCTGTCACGAACCCGCTTTGCGAGACAGTCGCGTCTCGAAGGGCTTCCCTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail