Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6423
Gene name
LocationContig_66:37589..38881
Strand-
Gene length (bp)1292
Transcript length (bp)1203
Coding sequence length (bp)1203
Protein length (aa) 401

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04194 PDCD2_C Programmed cell death protein 2, C-terminal putative domain 1.7E-34 280 393

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87156|TSR4_SCHPO Probable 20S rRNA accumulation protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC25H2.15 PE=3 SV=1 15 394 1.0E-36
sp|P25040|TSR4_YEAST 20S rRNA accumulation protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TSR4 PE=1 SV=2 35 394 6.0E-26
sp|Q8C5N5|PDD2L_MOUSE Programmed cell death protein 2-like OS=Mus musculus GN=Pdcd2l PE=1 SV=1 35 374 2.0E-18
sp|Q9BRP1|PDD2L_HUMAN Programmed cell death protein 2-like OS=Homo sapiens GN=PDCD2L PE=1 SV=1 35 374 5.0E-16
sp|Q5ZID2|PDD2L_CHICK Programmed cell death protein 2-like OS=Gallus gallus GN=PDCD2L PE=2 SV=1 278 374 8.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87156|TSR4_SCHPO Probable 20S rRNA accumulation protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC25H2.15 PE=3 SV=1 15 394 1.0E-36
sp|P25040|TSR4_YEAST 20S rRNA accumulation protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TSR4 PE=1 SV=2 35 394 6.0E-26
sp|Q8C5N5|PDD2L_MOUSE Programmed cell death protein 2-like OS=Mus musculus GN=Pdcd2l PE=1 SV=1 35 374 2.0E-18
sp|Q9BRP1|PDD2L_HUMAN Programmed cell death protein 2-like OS=Homo sapiens GN=PDCD2L PE=1 SV=1 35 374 5.0E-16
sp|Q5ZID2|PDD2L_CHICK Programmed cell death protein 2-like OS=Gallus gallus GN=PDCD2L PE=2 SV=1 278 374 8.0E-12
sp|P46718|PDCD2_MOUSE Programmed cell death protein 2 OS=Mus musculus GN=Pdcd2 PE=2 SV=2 232 392 6.0E-11
sp|Q09787|YA99_SCHPO Uncharacterized protein C13G6.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13G6.09 PE=4 SV=1 280 378 8.0E-10
sp|Q2YDC9|PDCD2_BOVIN Programmed cell death protein 2 OS=Bos taurus GN=PDCD2 PE=2 SV=1 232 392 2.0E-09
sp|P47816|PDCD2_RAT Programmed cell death protein 2 OS=Rattus norvegicus GN=Pdcd2 PE=2 SV=2 232 378 5.0E-09
sp|Q16342|PDCD2_HUMAN Programmed cell death protein 2 OS=Homo sapiens GN=PDCD2 PE=1 SV=2 232 373 6.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0005737 cytoplasm Yes
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6423
MAATEYDSDSTEDDFTETNVLLGFATQDGDADIISKLGGTPDWLDADNAPSAALARCQACKELMVLLLQLNGELP
DHFPGHERRLYVFACRRAGCRRKEGSVCVLRGVKIWEVEDAVEEDKAPSGDYKKSNQEAELGETLFGVTAMGSAN
PFAMNAPSPDPAPSNPFGEPPSLSGITKPEPATPASDREAVPCLSKTFAETLALNVAPSLEAASPGSPLEAWPVG
PARPKPYPTFYISEAEYETLDPSVLAPKHTPIRLDDADAPEPSVLDREAFESSMDVTFQKFADRLVQNPDQVIRY
EFAGSPLLYSTVDAVGMTLTRSAIPNCPNCGAARVFEVQLTPNAITQLEEGELGLEGMEWGTIIVGVCQSDCAPR
GVGKGKAGYLRDWVGVQWEELIKHK*
Coding >OphauG2|6423
ATGGCTGCAACCGAGTACGACTCGGATTCAACAGAAGACGACTTCACTGAGACGAATGTGCTCCTTGGGTTTGCA
ACACAAGATGGCGACGCAGACATAATTAGCAAGCTAGGCGGCACTCCGGACTGGCTCGATGCGGATAATGCGCCT
TCGGCAGCGCTAGCGCGATGTCAAGCGTGCAAAGAGCTGATGGTGTTGTTGTTGCAGCTCAATGGCGAATTGCCG
GATCACTTTCCGGGCCACGAACGACGACTTTATGTGTTTGCATGCAGACGAGCCGGGTGCCGGCGCAAGGAGGGC
AGCGTGTGCGTGCTGAGGGGTGTCAAGATATGGGAAGTGGAGGATGCGGTAGAGGAAGACAAGGCGCCGAGCGGA
GATTACAAAAAGAGCAATCAGGAAGCAGAACTTGGAGAGACACTCTTTGGCGTGACGGCAATGGGTAGCGCCAAC
CCATTTGCCATGAACGCACCATCGCCTGACCCTGCGCCGAGCAACCCATTTGGTGAACCGCCGTCTTTATCAGGC
ATCACGAAACCTGAGCCAGCAACTCCCGCTTCCGACAGAGAGGCAGTGCCTTGCTTGTCAAAGACGTTTGCCGAA
ACACTGGCTCTGAACGTGGCGCCATCACTCGAGGCTGCTTCTCCCGGATCACCTCTTGAAGCATGGCCTGTTGGC
CCTGCCCGACCGAAACCATACCCAACCTTTTACATCTCCGAGGCCGAGTATGAGACACTCGATCCATCAGTACTA
GCACCAAAGCATACGCCTATCCGCCTCGACGACGCAGACGCGCCCGAGCCGTCTGTTCTGGACCGTGAGGCATTC
GAATCGTCCATGGATGTTACTTTTCAGAAGTTCGCCGACCGCCTGGTGCAGAATCCGGACCAAGTCATTAGATAC
GAATTTGCTGGTTCCCCGCTGCTGTACTCGACGGTGGACGCTGTTGGTATGACTCTCACGAGATCAGCCATACCT
AATTGTCCCAATTGTGGCGCTGCCAGAGTATTTGAGGTGCAGCTTACGCCAAATGCTATTACTCAACTCGAAGAG
GGTGAACTCGGCCTTGAGGGCATGGAATGGGGAACCATTATTGTTGGCGTTTGCCAAAGCGACTGCGCACCCAGA
GGTGTGGGAAAGGGCAAGGCTGGATACCTAAGGGATTGGGTTGGTGTGCAATGGGAGGAGCTGATCAAGCATAAG
TGA
Transcript >OphauG2|6423
ATGGCTGCAACCGAGTACGACTCGGATTCAACAGAAGACGACTTCACTGAGACGAATGTGCTCCTTGGGTTTGCA
ACACAAGATGGCGACGCAGACATAATTAGCAAGCTAGGCGGCACTCCGGACTGGCTCGATGCGGATAATGCGCCT
TCGGCAGCGCTAGCGCGATGTCAAGCGTGCAAAGAGCTGATGGTGTTGTTGTTGCAGCTCAATGGCGAATTGCCG
GATCACTTTCCGGGCCACGAACGACGACTTTATGTGTTTGCATGCAGACGAGCCGGGTGCCGGCGCAAGGAGGGC
AGCGTGTGCGTGCTGAGGGGTGTCAAGATATGGGAAGTGGAGGATGCGGTAGAGGAAGACAAGGCGCCGAGCGGA
GATTACAAAAAGAGCAATCAGGAAGCAGAACTTGGAGAGACACTCTTTGGCGTGACGGCAATGGGTAGCGCCAAC
CCATTTGCCATGAACGCACCATCGCCTGACCCTGCGCCGAGCAACCCATTTGGTGAACCGCCGTCTTTATCAGGC
ATCACGAAACCTGAGCCAGCAACTCCCGCTTCCGACAGAGAGGCAGTGCCTTGCTTGTCAAAGACGTTTGCCGAA
ACACTGGCTCTGAACGTGGCGCCATCACTCGAGGCTGCTTCTCCCGGATCACCTCTTGAAGCATGGCCTGTTGGC
CCTGCCCGACCGAAACCATACCCAACCTTTTACATCTCCGAGGCCGAGTATGAGACACTCGATCCATCAGTACTA
GCACCAAAGCATACGCCTATCCGCCTCGACGACGCAGACGCGCCCGAGCCGTCTGTTCTGGACCGTGAGGCATTC
GAATCGTCCATGGATGTTACTTTTCAGAAGTTCGCCGACCGCCTGGTGCAGAATCCGGACCAAGTCATTAGATAC
GAATTTGCTGGTTCCCCGCTGCTGTACTCGACGGTGGACGCTGTTGGTATGACTCTCACGAGATCAGCCATACCT
AATTGTCCCAATTGTGGCGCTGCCAGAGTATTTGAGGTGCAGCTTACGCCAAATGCTATTACTCAACTCGAAGAG
GGTGAACTCGGCCTTGAGGGCATGGAATGGGGAACCATTATTGTTGGCGTTTGCCAAAGCGACTGCGCACCCAGA
GGTGTGGGAAAGGGCAAGGCTGGATACCTAAGGGATTGGGTTGGTGTGCAATGGGAGGAGCTGATCAAGCATAAG
TGA
Gene >OphauG2|6423
ATGGCTGCAACCGAGTACGACTCGGATTCAACAGAAGACGACTTCACTGAGACGAATGTGCTCCTTGGGTTTGCA
ACACAAGATGGCGACGCAGACATAATTAGCAAGCTAGGCGGCACTCCGGTATGCTTAGGGGCCATCGGGCCTTCT
ACAATCTTGGGCATCGCAAAGACGAGAACCTGGCTAACTTGATTCGCGCACCCGCCACTTAGGACTGGCTCGATG
CGGATAATGCGCCTTCGGCAGCGCTAGCGCGATGTCAAGCGTGCAAAGAGCTGATGGTGTTGTTGTTGCAGCTCA
ATGGCGAATTGCCGGATCACTTTCCGGGCCACGAACGACGACTTTATGTGTTTGCATGCAGACGAGCCGGGTGCC
GGCGCAAGGAGGGCAGCGTGTGCGTGCTGAGGGGTGTCAAGATATGGGAAGTGGAGGATGCGGTAGAGGAAGACA
AGGCGCCGAGCGGAGATTACAAAAAGAGCAATCAGGAAGCAGAACTTGGAGAGACACTCTTTGGCGTGACGGCAA
TGGGTAGCGCCAACCCATTTGCCATGAACGCACCATCGCCTGACCCTGCGCCGAGCAACCCATTTGGTGAACCGC
CGTCTTTATCAGGCATCACGAAACCTGAGCCAGCAACTCCCGCTTCCGACAGAGAGGCAGTGCCTTGCTTGTCAA
AGACGTTTGCCGAAACACTGGCTCTGAACGTGGCGCCATCACTCGAGGCTGCTTCTCCCGGATCACCTCTTGAAG
CATGGCCTGTTGGCCCTGCCCGACCGAAACCATACCCAACCTTTTACATCTCCGAGGCCGAGTATGAGACACTCG
ATCCATCAGTACTAGCACCAAAGCATACGCCTATCCGCCTCGACGACGCAGACGCGCCCGAGCCGTCTGTTCTGG
ACCGTGAGGCATTCGAATCGTCCATGGATGTTACTTTTCAGAAGTTCGCCGACCGCCTGGTGCAGAATCCGGACC
AAGTCATTAGATACGAATTTGCTGGTTCCCCGCTGCTGTACTCGACGGTGGACGCTGTTGGTATGACTCTCACGA
GATCAGCCATACCTAATTGTCCCAATTGTGGCGCTGCCAGAGTATTTGAGGTGCAGCTTACGCCAAATGCTATTA
CTCAACTCGAAGAGGGTGAACTCGGCCTTGAGGGCATGGAATGGGGAACCATTATTGTTGGCGTTTGCCAAAGCG
ACTGCGCACCCAGAGGTGTGGGAAAGGGCAAGGCTGGATACCTAAGGGATTGGGTTGGTGTGCAATGGGAGGAGC
TGATCAAGCATAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail