Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6420
Gene name
LocationContig_66:29615..32098
Strand-
Gene length (bp)2483
Transcript length (bp)2235
Coding sequence length (bp)2235
Protein length (aa) 745

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01602 Adaptin_N Adaptin N terminal region 2.3E-134 17 531
PF12717 Cnd1 non-SMC mitotic condensation complex subunit 1 3.5E-62 104 267
PF13646 HEAT_2 HEAT repeats 2.3E-06 127 214

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SUS3|APBLB_ARATH Beta-adaptin-like protein B OS=Arabidopsis thaliana GN=BETAB-AD PE=1 SV=1 10 581 0.0E+00
sp|P62944|AP2B1_RAT AP-2 complex subunit beta OS=Rattus norvegicus GN=Ap2b1 PE=1 SV=1 10 729 0.0E+00
sp|O43079|AP1B1_SCHPO AP-1 complex subunit beta-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apl2 PE=1 SV=1 10 701 0.0E+00
sp|O81742|APBLC_ARATH Beta-adaptin-like protein C OS=Arabidopsis thaliana GN=BETAC-AD PE=1 SV=2 10 633 0.0E+00
sp|Q54X82|AP1B_DICDI AP-1 complex subunit beta OS=Dictyostelium discoideum GN=ap1b1 PE=3 SV=1 10 581 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SUS3|APBLB_ARATH Beta-adaptin-like protein B OS=Arabidopsis thaliana GN=BETAB-AD PE=1 SV=1 10 581 0.0E+00
sp|P62944|AP2B1_RAT AP-2 complex subunit beta OS=Rattus norvegicus GN=Ap2b1 PE=1 SV=1 10 729 0.0E+00
sp|O43079|AP1B1_SCHPO AP-1 complex subunit beta-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apl2 PE=1 SV=1 10 701 0.0E+00
sp|O81742|APBLC_ARATH Beta-adaptin-like protein C OS=Arabidopsis thaliana GN=BETAC-AD PE=1 SV=2 10 633 0.0E+00
sp|Q54X82|AP1B_DICDI AP-1 complex subunit beta OS=Dictyostelium discoideum GN=ap1b1 PE=3 SV=1 10 581 0.0E+00
sp|P52303|AP1B1_RAT AP-1 complex subunit beta-1 OS=Rattus norvegicus GN=Ap1b1 PE=1 SV=1 10 583 0.0E+00
sp|O35643|AP1B1_MOUSE AP-1 complex subunit beta-1 OS=Mus musculus GN=Ap1b1 PE=1 SV=2 10 583 0.0E+00
sp|Q10567|AP1B1_HUMAN AP-1 complex subunit beta-1 OS=Homo sapiens GN=AP1B1 PE=1 SV=2 10 730 0.0E+00
sp|Q08DS7|AP1B1_BOVIN AP-1 complex subunit beta-1 OS=Bos taurus GN=AP2B1 PE=2 SV=1 10 612 0.0E+00
sp|Q9DBG3|AP2B1_MOUSE AP-2 complex subunit beta OS=Mus musculus GN=Ap2b1 PE=1 SV=1 10 729 0.0E+00
sp|P63009|AP2B1_BOVIN AP-2 complex subunit beta OS=Bos taurus GN=AP2B1 PE=1 SV=2 10 729 0.0E+00
sp|P63010|AP2B1_HUMAN AP-2 complex subunit beta OS=Homo sapiens GN=AP2B1 PE=1 SV=1 10 729 0.0E+00
sp|P36000|AP1B1_YEAST AP-1 complex subunit beta-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APL2 PE=1 SV=1 4 668 2.0E-169
sp|O43005|AP2B_SCHPO AP-2 complex subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apl1 PE=3 SV=1 32 579 2.0E-139
sp|Q9LDK9|APBLA_ARATH Beta-adaptin-like protein A OS=Arabidopsis thaliana GN=BETAA-AD PE=1 SV=1 33 702 4.0E-101
sp|Q9WV76|AP4B1_MOUSE AP-4 complex subunit beta-1 OS=Mus musculus GN=Ap4b1 PE=1 SV=2 34 581 7.0E-83
sp|Q9Y6B7|AP4B1_HUMAN AP-4 complex subunit beta-1 OS=Homo sapiens GN=AP4B1 PE=1 SV=2 34 530 3.0E-80
sp|Q13367|AP3B2_HUMAN AP-3 complex subunit beta-2 OS=Homo sapiens GN=AP3B2 PE=1 SV=2 35 530 2.0E-68
sp|Q9JME5|AP3B2_MOUSE AP-3 complex subunit beta-2 OS=Mus musculus GN=Ap3b2 PE=1 SV=2 35 530 3.0E-68
sp|Q7YRF1|AP3B1_CANLF AP-3 complex subunit beta-1 OS=Canis lupus familiaris GN=AP3B1 PE=2 SV=1 8 543 4.0E-66
sp|Q54R84|AP4B_DICDI AP-4 complex subunit beta OS=Dictyostelium discoideum GN=ap4b1 PE=3 SV=1 34 583 4.0E-65
sp|Q32PG1|AP3B1_BOVIN AP-3 complex subunit beta-1 OS=Bos taurus GN=AP3B1 PE=2 SV=1 8 543 1.0E-64
sp|Q9Z1T1|AP3B1_MOUSE AP-3 complex subunit beta-1 OS=Mus musculus GN=Ap3b1 PE=1 SV=2 8 541 4.0E-64
sp|O00203|AP3B1_HUMAN AP-3 complex subunit beta-1 OS=Homo sapiens GN=AP3B1 PE=1 SV=3 8 543 6.0E-64
sp|P27351|AP2B_YEAST AP-2 complex subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APL1 PE=1 SV=2 33 574 1.0E-61
sp|O13939|AP3B_SCHPO AP-3 complex subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apl6 PE=1 SV=1 35 531 1.0E-38
sp|Q556J8|AP3B_DICDI AP-3 complex subunit beta OS=Dictyostelium discoideum GN=ap3b-1 PE=3 SV=1 252 551 3.0E-26
sp|Q556J8|AP3B_DICDI AP-3 complex subunit beta OS=Dictyostelium discoideum GN=ap3b-1 PE=3 SV=1 20 232 1.0E-25
sp|P46682|AP3B_YEAST AP-3 complex subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APL6 PE=1 SV=2 20 492 4.0E-23
sp|Q9M2T1|AP3BA_ARATH AP3-complex subunit beta-A OS=Arabidopsis thaliana GN=AP3BA PE=2 SV=2 282 536 3.0E-17
sp|Q759E2|AP3B_ASHGO AP-3 complex subunit beta OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=APL6 PE=3 SV=2 10 181 3.0E-16
sp|Q9U4N3|COPB_TOXGO Coatomer subunit beta OS=Toxoplasma gondii PE=2 SV=2 18 472 6.0E-08
sp|Q99128|AP1G1_USTMA AP-1 complex subunit gamma-1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=APL4 PE=3 SV=3 17 457 6.0E-08
sp|Q5R5M2|AP1G1_PONAB AP-1 complex subunit gamma-1 OS=Pongo abelii GN=AP1G1 PE=2 SV=1 17 213 1.0E-07
sp|O43747|AP1G1_HUMAN AP-1 complex subunit gamma-1 OS=Homo sapiens GN=AP1G1 PE=1 SV=5 56 558 2.0E-07
sp|P22892|AP1G1_MOUSE AP-1 complex subunit gamma-1 OS=Mus musculus GN=Ap1g1 PE=1 SV=3 56 213 2.0E-07
sp|Q7QG73|AP2A_ANOGA AP-2 complex subunit alpha OS=Anopheles gambiae GN=alpha-Adaptin PE=3 SV=4 30 556 5.0E-07
sp|Q759E2|AP3B_ASHGO AP-3 complex subunit beta OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=APL6 PE=3 SV=2 298 535 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006886 intracellular protein transport Yes
GO:0016192 vesicle-mediated transport Yes
GO:0030117 membrane coat Yes
GO:0032991 protein-containing complex No
GO:0070727 cellular macromolecule localization No
GO:0098796 membrane protein complex No
GO:0051179 localization No
GO:0071702 organic substance transport No
GO:0015031 protein transport No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0071705 nitrogen compound transport No
GO:0008104 protein localization No
GO:0051641 cellular localization No
GO:0045184 establishment of protein localization No
GO:0051649 establishment of localization in cell No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0046907 intracellular transport No
GO:0033036 macromolecule localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6420
MAVNRIRGAFAVPRKGETFELRAGLVSQYAWERKESIQKTIMAMTLGKDVSALFPDVLKNIATGDLDQKKLVYLY
LMNYAKSHPDLCILAVNTFVQDSEDPNPLIRALAIRTMGCIRVDKMVDYMEEPLRKTLRDESPYVRKTAAICVAK
LFDLNPTMCIENGFLETLQEMIGDPNPMVVANSVQALSEITETAPETKALIVTPPILKKLLMALNECTEWGRITI
LSTLADYQSVDAKESEHICERVVPQFQHVNPSVVLAAIKVVFTHMKAVNPELVRSCLKKMAPPLVTLVASAPEVQ
YVALRNIDLLLQAKPDILSKELRVFFCKYNDPPYVKLQKLEIMVRIANEKNYEQLLAELKEYALEVDMDFVRRAV
KAIGQVAIKIEAASPKCVQALEDLISTKVNYVVQEAIVVIKDILRKYPGYEAVIPTLCKHIDELDEPNARGSLIW
IVGEYAEKISNAAEILESFVEAFNEEFTQTQLQILTAVVKLFLKKPSNTQGLVQKVLQAATAENDNADIRDRAYV
YWRLLSGDLESIILSQKPTISTTMTSLPPALLEQLLAELSTLASVYHKPPESFVGKGRFGADEIQRAAIQEQRQN
AAENPIAASVAAAAAANSSGRPAVSQNNVENLLDIDFDGAAPASQEQQSASATPERVASPFGGSSSGGMADMMSM
FDAPGPSSSNSAPSMGGGMNDLMSGFGDMNFGGGAPSGEPLPAAMQLQNAQGSGSQGPKKDSDDLLGLL*
Coding >OphauG2|6420
ATGGCCGTAAACCGTATACGCGGCGCCTTTGCCGTGCCTCGCAAAGGCGAGACGTTTGAGCTGAGGGCCGGCCTC
GTCTCCCAATATGCCTGGGAACGCAAGGAGTCGATACAAAAAACCATCATGGCCATGACGCTTGGCAAAGACGTC
TCTGCTCTCTTTCCAGATGTGTTGAAGAACATTGCGACGGGGGATCTGGATCAAAAGAAGCTTGTCTACCTCTAC
CTCATGAACTATGCAAAGTCACATCCAGATCTTTGCATTCTTGCCGTCAACACCTTTGTCCAAGACTCGGAGGAT
CCTAACCCCTTGATACGAGCTCTGGCCATCCGCACCATGGGTTGCATCCGCGTAGACAAAATGGTGGACTACATG
GAAGAACCGTTACGCAAGACTCTGCGCGACGAGTCTCCCTACGTCCGAAAAACTGCGGCCATCTGTGTTGCCAAG
CTGTTTGATCTCAACCCCACCATGTGCATCGAGAACGGCTTTTTAGAGACGCTACAAGAAATGATTGGCGATCCG
AATCCAATGGTGGTGGCCAATTCGGTACAAGCTCTGTCTGAAATTACCGAGACAGCTCCAGAGACCAAGGCGCTC
ATTGTCACGCCTCCGATTCTCAAAAAGCTGCTAATGGCTCTCAACGAATGCACCGAATGGGGAAGAATCACAATA
TTGAGCACGCTGGCCGACTACCAGTCGGTAGATGCCAAGGAGTCGGAGCATATTTGTGAACGAGTGGTGCCTCAG
TTCCAACACGTGAACCCCAGCGTTGTTCTAGCCGCCATCAAGGTCGTCTTCACACATATGAAGGCCGTCAACCCT
GAACTTGTCAGGTCATGTCTCAAAAAGATGGCTCCCCCTCTTGTAACATTAGTGGCATCTGCCCCCGAAGTACAG
TACGTGGCGCTGCGCAATATTGACTTGCTTTTGCAGGCAAAACCAGACATATTGAGCAAAGAGCTGCGTGTCTTC
TTCTGCAAATATAACGACCCGCCATATGTAAAGCTCCAGAAGCTCGAAATCATGGTGAGAATAGCAAATGAAAAG
AACTATGAGCAGCTGCTTGCAGAGCTCAAGGAATACGCGCTTGAGGTGGACATGGACTTTGTGCGAAGAGCTGTC
AAGGCCATTGGACAAGTAGCCATCAAGATAGAAGCGGCCAGCCCCAAGTGTGTTCAGGCCCTCGAGGATCTGATT
TCGACAAAAGTCAACTATGTGGTACAAGAAGCCATTGTCGTCATCAAGGACATTTTGCGCAAATATCCCGGATAT
GAAGCAGTTATCCCGACGCTTTGCAAGCACATCGATGAGCTCGACGAGCCCAACGCTCGTGGGTCGCTCATATGG
ATTGTTGGCGAATATGCTGAGAAGATTAGCAACGCTGCCGAAATTCTAGAAAGCTTCGTTGAGGCATTTAACGAA
GAATTTACCCAGACTCAACTTCAAATCCTGACGGCTGTTGTCAAGCTATTTCTCAAGAAGCCCAGCAACACCCAA
GGCCTCGTACAAAAGGTCCTACAAGCTGCAACAGCCGAAAACGACAATGCAGATATCCGCGACAGGGCATACGTG
TACTGGCGCCTGCTCTCGGGCGATCTCGAAAGCATTATCCTTTCACAAAAACCAACAATCTCTACCACAATGACG
TCGCTGCCGCCGGCTTTGCTGGAACAGCTGCTGGCGGAACTGTCGACGCTAGCCTCGGTCTACCACAAGCCTCCC
GAGTCGTTTGTTGGCAAGGGTCGGTTTGGAGCGGATGAAATCCAGCGTGCAGCCATTCAAGAACAGCGGCAGAAC
GCAGCCGAGAATCCTATTGCGGCCTCGGTGGCAGCTGCGGCAGCAGCCAACAGCTCTGGCAGGCCAGCAGTCTCG
CAGAACAATGTGGAGAATCTGCTCGACATTGACTTTGATGGAGCAGCCCCTGCGTCGCAAGAACAGCAGAGCGCT
TCGGCTACGCCAGAGCGTGTGGCTAGCCCGTTTGGTGGTTCCTCGTCGGGAGGCATGGCCGACATGATGAGCATG
TTTGATGCACCAGGGCCGAGCAGCAGCAATAGCGCGCCGAGTATGGGTGGAGGCATGAATGATCTCATGAGTGGA
TTTGGAGACATGAACTTTGGAGGGGGTGCACCTTCTGGTGAACCATTGCCAGCTGCAATGCAGTTGCAGAATGCC
CAAGGCAGTGGCTCGCAAGGGCCCAAAAAGGATAGCGATGACTTACTGGGACTACTGTAA
Transcript >OphauG2|6420
ATGGCCGTAAACCGTATACGCGGCGCCTTTGCCGTGCCTCGCAAAGGCGAGACGTTTGAGCTGAGGGCCGGCCTC
GTCTCCCAATATGCCTGGGAACGCAAGGAGTCGATACAAAAAACCATCATGGCCATGACGCTTGGCAAAGACGTC
TCTGCTCTCTTTCCAGATGTGTTGAAGAACATTGCGACGGGGGATCTGGATCAAAAGAAGCTTGTCTACCTCTAC
CTCATGAACTATGCAAAGTCACATCCAGATCTTTGCATTCTTGCCGTCAACACCTTTGTCCAAGACTCGGAGGAT
CCTAACCCCTTGATACGAGCTCTGGCCATCCGCACCATGGGTTGCATCCGCGTAGACAAAATGGTGGACTACATG
GAAGAACCGTTACGCAAGACTCTGCGCGACGAGTCTCCCTACGTCCGAAAAACTGCGGCCATCTGTGTTGCCAAG
CTGTTTGATCTCAACCCCACCATGTGCATCGAGAACGGCTTTTTAGAGACGCTACAAGAAATGATTGGCGATCCG
AATCCAATGGTGGTGGCCAATTCGGTACAAGCTCTGTCTGAAATTACCGAGACAGCTCCAGAGACCAAGGCGCTC
ATTGTCACGCCTCCGATTCTCAAAAAGCTGCTAATGGCTCTCAACGAATGCACCGAATGGGGAAGAATCACAATA
TTGAGCACGCTGGCCGACTACCAGTCGGTAGATGCCAAGGAGTCGGAGCATATTTGTGAACGAGTGGTGCCTCAG
TTCCAACACGTGAACCCCAGCGTTGTTCTAGCCGCCATCAAGGTCGTCTTCACACATATGAAGGCCGTCAACCCT
GAACTTGTCAGGTCATGTCTCAAAAAGATGGCTCCCCCTCTTGTAACATTAGTGGCATCTGCCCCCGAAGTACAG
TACGTGGCGCTGCGCAATATTGACTTGCTTTTGCAGGCAAAACCAGACATATTGAGCAAAGAGCTGCGTGTCTTC
TTCTGCAAATATAACGACCCGCCATATGTAAAGCTCCAGAAGCTCGAAATCATGGTGAGAATAGCAAATGAAAAG
AACTATGAGCAGCTGCTTGCAGAGCTCAAGGAATACGCGCTTGAGGTGGACATGGACTTTGTGCGAAGAGCTGTC
AAGGCCATTGGACAAGTAGCCATCAAGATAGAAGCGGCCAGCCCCAAGTGTGTTCAGGCCCTCGAGGATCTGATT
TCGACAAAAGTCAACTATGTGGTACAAGAAGCCATTGTCGTCATCAAGGACATTTTGCGCAAATATCCCGGATAT
GAAGCAGTTATCCCGACGCTTTGCAAGCACATCGATGAGCTCGACGAGCCCAACGCTCGTGGGTCGCTCATATGG
ATTGTTGGCGAATATGCTGAGAAGATTAGCAACGCTGCCGAAATTCTAGAAAGCTTCGTTGAGGCATTTAACGAA
GAATTTACCCAGACTCAACTTCAAATCCTGACGGCTGTTGTCAAGCTATTTCTCAAGAAGCCCAGCAACACCCAA
GGCCTCGTACAAAAGGTCCTACAAGCTGCAACAGCCGAAAACGACAATGCAGATATCCGCGACAGGGCATACGTG
TACTGGCGCCTGCTCTCGGGCGATCTCGAAAGCATTATCCTTTCACAAAAACCAACAATCTCTACCACAATGACG
TCGCTGCCGCCGGCTTTGCTGGAACAGCTGCTGGCGGAACTGTCGACGCTAGCCTCGGTCTACCACAAGCCTCCC
GAGTCGTTTGTTGGCAAGGGTCGGTTTGGAGCGGATGAAATCCAGCGTGCAGCCATTCAAGAACAGCGGCAGAAC
GCAGCCGAGAATCCTATTGCGGCCTCGGTGGCAGCTGCGGCAGCAGCCAACAGCTCTGGCAGGCCAGCAGTCTCG
CAGAACAATGTGGAGAATCTGCTCGACATTGACTTTGATGGAGCAGCCCCTGCGTCGCAAGAACAGCAGAGCGCT
TCGGCTACGCCAGAGCGTGTGGCTAGCCCGTTTGGTGGTTCCTCGTCGGGAGGCATGGCCGACATGATGAGCATG
TTTGATGCACCAGGGCCGAGCAGCAGCAATAGCGCGCCGAGTATGGGTGGAGGCATGAATGATCTCATGAGTGGA
TTTGGAGACATGAACTTTGGAGGGGGTGCACCTTCTGGTGAACCATTGCCAGCTGCAATGCAGTTGCAGAATGCC
CAAGGCAGTGGCTCGCAAGGGCCCAAAAAGGATAGCGATGACTTACTGGGACTACTGTAA
Gene >OphauG2|6420
ATGGCCGTAAACCGTATACGCGGCGCCTTTGCCGTGCCTCGCAAAGGCGAGACGTTTGAGCTGAGGGCCGGCCTC
GTCTCCCAATATGCCTGGGAACGCAAGGAGTCGATACAAAAAACCATCATGGCCATGACGCTTGGCAAAGACGTC
TCTGCTCTCTTTCCAGATGTGTTGAAGAACATTGCGACGGGGGATCTGGATCAAAAGAAGCTTGTCTACCTCTAC
CTCATGTGGGTGCCTCTCGGACAGACCGTGAAGCAATTTCTCTGACAAGAGACCCAGGAACTATGCAAAGTCACA
TCCAGATCTTTGCATTCTTGCCGTCAACACCTTTGTCCAAGACTCGGAGGATCCTAACCCCTTGATACGAGCTCT
GGCCATCCGCACCATGGGTTGCATCCGCGTAGACAAAATGGTGGACTACATGGAAGAACCGTTACGCAAGACTCT
GCGCGACGAGTCTCCCTACGTCCGAAAAACTGCGGCCATCTGTGTTGCCAAGCTGTTTGATCTCAACCCCACCAT
GTGCATCGAGAACGGCTTTTTAGAGACGCTACAAGAAATGATTGGCGATCCGAATCCAATGGTGGTGGCCAATTC
GGTACAAGCTCTGTCTGAAATTACCGAGACAGCTCCAGAGACCAAGGCGCTCATTGTCACGCCTCCGATTCTCAA
AAAGCTGCTAATGGCTCTCAACGAATGCACCGAATGGGGAAGAATCACAATATTGAGCACGCTGGCCGACTACCA
GTCGGTAGATGCCAAGGAGTCGGAGCATATTTGTGAACGAGTGGTGCCTCAGTTCCAACACGTGAACCCCAGCGT
TGTTCTAGCCGCCATCAAGGTCGTCTTCACACATATGAAGGCCGTCAACCCTGAACTTGTCAGGTCATGTCTCAA
AAAGATGGCTCCCCCTCTTGGTACGTGGCAATCTATTCTGATGGTCATCGCAGCGTGATTGTATTGCTAACATTT
TTTTCTTCTCTTACTTCAGTAACATTAGTGGCATCTGCCCCCGAAGTACAGTACGTGGCGCTGCGCAATATTGAC
TTGCTTTTGCAGGCAAAACCAGACATATTGAGCAAAGAGCTGCGTGTCTTCTTCTGCAAATATAACGACCCGCCA
TATGTAAAGCTCCAGAAGCTCGAAATCATGGTGAGAATAGCAAATGAAAAGAACTATGAGCAGCTGCTTGCAGAG
CTCAAGGAATACGCGCTTGAGGTGGACATGGACTTTGTGCGAAGAGCTGTCAAGGCCATTGGACAAGTAGCCATC
AAGATAGAAGCGGCCAGCCCCAAGTGTGTTCAGGCCCTCGAGGATCTGATTTCGACAAAAGTCAACTATGTGGTA
CAAGAAGCCATTGTCGTCATCAAGGACATTTTGCGCAAATATCCCGGATATGAAGCAGTTATCCCGACGCTTTGC
AAGCACATCGATGAGCTCGACGAGCCCAACGCTCGTGGGTCGCTCATATGGATTGTTGGCGAATATGCTGAGAAG
ATTAGCAACGCTGCCGAAATTCTAGAAAGCTTCGTTGAGGCATTTAACGAAGAATTTACCCAGGTTTGTACCAGG
ATACTTTGGACACCGAGGAGAGTGGGGAAAATGCTAATGCTGAAATGACAGACTCAACTTCAAATCCTGACGGCT
GTTGTCAAGCTATTTCTCAAGAAGCCCAGCAACACCCAAGGCCTCGTACAAAAGGTCCTACAAGCTGCAACAGCC
GAAAACGACAATGCAGATATCCGCGACAGGGCATACGTGTACTGGCGCCTGCTCTCGGGCGATCTCGAAGTGGCC
AAGGCAAGTTGAAGAGTGAGTGGATGTTGGGTTTTTACTGACGAGGCGACTAGAGCATTATCCTTTCACAAAAAC
CAACAATCTCTACCACAATGACGTCGCTGCCGCCGGCTTTGCTGGAACAGCTGCTGGCGGAACTGTCGACGCTAG
CCTCGGTCTACCACAAGCCTCCCGAGTCGTTTGTTGGCAAGGGTCGGTTTGGAGCGGATGAAATCCAGCGTGCAG
CCATTCAAGAACAGCGGCAGAACGCAGCCGAGAATCCTATTGCGGCCTCGGTGGCAGCTGCGGCAGCAGCCAACA
GCTCTGGCAGGCCAGCAGTCTCGCAGAACAATGTGGAGAATCTGCTCGACATTGACTTTGATGGAGCAGCCCCTG
CGTCGCAAGAACAGCAGAGCGCTTCGGCTACGCCAGAGCGTGTGGCTAGCCCGTTTGGTGGTTCCTCGTCGGGAG
GCATGGCCGACATGATGAGCATGTTTGATGCACCAGGGCCGAGCAGCAGCAATAGCGCGCCGAGTATGGGTGGAG
GCATGAATGATCTCATGAGTGGATTTGGAGACATGAACTTTGGAGGGGGTGCACCTTCTGGTGAACCATTGCCAG
CTGCAATGCAGTTGCAGAATGCCCAAGGCAGTGGCTCGCAAGGGCCCAAAAAGGATAGCGATGACTTACTGGGAC
TACTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail