Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6416
Gene name
LocationContig_66:25568..26294
Strand-
Gene length (bp)726
Transcript length (bp)726
Coding sequence length (bp)726
Protein length (aa) 242

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08585 RMI1_N RecQ mediated genome instability protein 2.4E-49 13 227

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10160|RMI1_SCHPO RecQ-mediated genome instability protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rmi1 PE=3 SV=1 48 228 4.0E-08

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6649
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6416 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3345
Ophiocordyceps kimflemingae Ophio5|5672
Ophiocordyceps subramaniannii Hirsu2|4819

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6416
MDLAFQLRASLLAQSLPPPSTAFISSLVAARSPPPPLPSLLATARARLLACDLCSSSLVDAALLCPLPAQLDAPA
LRLPRDVHVQVVDVENMSIPRWDQAQKLQAIAQGQEKRGRQVVRVQADAPDAPGASSSASSSSSSAAAAAAAAAG
ANATHRLVLQDRQGTRVYAVELRRDMRIGIGKTNIGEKIVLRAGTSVARGIVLLSPETCLLLGGKVEAWHNAWVE
GRLARLMEAVGCQAQQ*
Coding >OphauG2|6416
ATGGATCTTGCCTTTCAGCTGCGAGCCTCGCTCCTCGCCCAGTCGCTTCCCCCGCCGTCGACGGCCTTTATCTCA
TCGCTCGTTGCCGCTCGCTCGCCGCCGCCGCCTCTGCCCTCCCTGCTGGCCACGGCTCGCGCCCGCCTGTTGGCC
TGCGACCTCTGCTCGAGCAGTCTTGTCGATGCTGCGCTGCTGTGCCCTCTACCTGCGCAACTCGACGCCCCCGCG
CTGCGTCTGCCTCGCGACGTGCACGTCCAAGTTGTTGATGTGGAAAACATGAGCATTCCGCGCTGGGACCAGGCC
CAAAAGCTTCAAGCAATTGCCCAAGGCCAGGAGAAGCGAGGCCGCCAGGTGGTGCGTGTCCAGGCCGATGCGCCC
GATGCGCCGGGAGCATCATCATCAGCATCATCATCATCATCATCAGCAGCAGCAGCAGCAGCAGCAGCAGCTGGC
GCAAATGCCACCCATCGCCTCGTTCTACAGGACCGCCAGGGCACTCGCGTCTACGCCGTCGAGCTGCGCCGCGAC
ATGCGCATTGGAATCGGCAAGACAAACATTGGCGAGAAGATTGTGCTGCGAGCCGGCACGTCGGTTGCGCGCGGC
ATCGTGCTCCTCAGCCCAGAGACCTGCCTGTTGCTCGGCGGCAAGGTCGAGGCCTGGCACAATGCCTGGGTCGAG
GGCCGCCTGGCACGGCTAATGGAAGCCGTTGGCTGTCAAGCACAACAGTAG
Transcript >OphauG2|6416
ATGGATCTTGCCTTTCAGCTGCGAGCCTCGCTCCTCGCCCAGTCGCTTCCCCCGCCGTCGACGGCCTTTATCTCA
TCGCTCGTTGCCGCTCGCTCGCCGCCGCCGCCTCTGCCCTCCCTGCTGGCCACGGCTCGCGCCCGCCTGTTGGCC
TGCGACCTCTGCTCGAGCAGTCTTGTCGATGCTGCGCTGCTGTGCCCTCTACCTGCGCAACTCGACGCCCCCGCG
CTGCGTCTGCCTCGCGACGTGCACGTCCAAGTTGTTGATGTGGAAAACATGAGCATTCCGCGCTGGGACCAGGCC
CAAAAGCTTCAAGCAATTGCCCAAGGCCAGGAGAAGCGAGGCCGCCAGGTGGTGCGTGTCCAGGCCGATGCGCCC
GATGCGCCGGGAGCATCATCATCAGCATCATCATCATCATCATCAGCAGCAGCAGCAGCAGCAGCAGCAGCTGGC
GCAAATGCCACCCATCGCCTCGTTCTACAGGACCGCCAGGGCACTCGCGTCTACGCCGTCGAGCTGCGCCGCGAC
ATGCGCATTGGAATCGGCAAGACAAACATTGGCGAGAAGATTGTGCTGCGAGCCGGCACGTCGGTTGCGCGCGGC
ATCGTGCTCCTCAGCCCAGAGACCTGCCTGTTGCTCGGCGGCAAGGTCGAGGCCTGGCACAATGCCTGGGTCGAG
GGCCGCCTGGCACGGCTAATGGAAGCCGTTGGCTGTCAAGCACAACAGTAG
Gene >OphauG2|6416
ATGGATCTTGCCTTTCAGCTGCGAGCCTCGCTCCTCGCCCAGTCGCTTCCCCCGCCGTCGACGGCCTTTATCTCA
TCGCTCGTTGCCGCTCGCTCGCCGCCGCCGCCTCTGCCCTCCCTGCTGGCCACGGCTCGCGCCCGCCTGTTGGCC
TGCGACCTCTGCTCGAGCAGTCTTGTCGATGCTGCGCTGCTGTGCCCTCTACCTGCGCAACTCGACGCCCCCGCG
CTGCGTCTGCCTCGCGACGTGCACGTCCAAGTTGTTGATGTGGAAAACATGAGCATTCCGCGCTGGGACCAGGCC
CAAAAGCTTCAAGCAATTGCCCAAGGCCAGGAGAAGCGAGGCCGCCAGGTGGTGCGTGTCCAGGCCGATGCGCCC
GATGCGCCGGGAGCATCATCATCAGCATCATCATCATCATCATCAGCAGCAGCAGCAGCAGCAGCAGCAGCTGGC
GCAAATGCCACCCATCGCCTCGTTCTACAGGACCGCCAGGGCACTCGCGTCTACGCCGTCGAGCTGCGCCGCGAC
ATGCGCATTGGAATCGGCAAGACAAACATTGGCGAGAAGATTGTGCTGCGAGCCGGCACGTCGGTTGCGCGCGGC
ATCGTGCTCCTCAGCCCAGAGACCTGCCTGTTGCTCGGCGGCAAGGTCGAGGCCTGGCACAATGCCTGGGTCGAG
GGCCGCCTGGCACGGCTAATGGAAGCCGTTGGCTGTCAAGCACAACAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail