Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6415
Gene name
LocationContig_66:21164..25491
Strand+
Gene length (bp)4327
Transcript length (bp)4248
Coding sequence length (bp)4248
Protein length (aa) 1416

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18833 TPR_22 Tetratricopeptide repeat 2.2E-24 142 229
PF13181 TPR_8 Tetratricopeptide repeat 4.5E-03 990 1020
PF13432 TPR_16 Tetratricopeptide repeat 7.0E-07 8 72
PF13176 TPR_7 Tetratricopeptide repeat 8.9E-04 734 765

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94474|SKI3_SCHPO Superkiller protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ski3 PE=3 SV=1 5 1404 3.0E-178
sp|P17883|SKI3_YEAST Superkiller protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKI3 PE=1 SV=2 1 1405 3.0E-107
sp|Q6DFB8|TTC37_XENLA Tetratricopeptide repeat protein 37 OS=Xenopus laevis GN=ttc37 PE=2 SV=1 523 1052 9.0E-45
sp|Q6PGP7|TTC37_HUMAN Tetratricopeptide repeat protein 37 OS=Homo sapiens GN=TTC37 PE=1 SV=1 523 1032 2.0E-39
sp|F4I3Z5|SKI3_ARATH Tetratricopeptide repeat protein SKI3 OS=Arabidopsis thaliana GN=SKI3 PE=1 SV=1 523 820 3.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94474|SKI3_SCHPO Superkiller protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ski3 PE=3 SV=1 5 1404 3.0E-178
sp|P17883|SKI3_YEAST Superkiller protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKI3 PE=1 SV=2 1 1405 3.0E-107
sp|Q6DFB8|TTC37_XENLA Tetratricopeptide repeat protein 37 OS=Xenopus laevis GN=ttc37 PE=2 SV=1 523 1052 9.0E-45
sp|Q6PGP7|TTC37_HUMAN Tetratricopeptide repeat protein 37 OS=Homo sapiens GN=TTC37 PE=1 SV=1 523 1032 2.0E-39
sp|F4I3Z5|SKI3_ARATH Tetratricopeptide repeat protein SKI3 OS=Arabidopsis thaliana GN=SKI3 PE=1 SV=1 523 820 3.0E-10
sp|F4I3Z5|SKI3_ARATH Tetratricopeptide repeat protein SKI3 OS=Arabidopsis thaliana GN=SKI3 PE=1 SV=1 947 1029 1.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6415
MAQLKAALKLINEAIRQHKFDDAIQKSREYLAKDPKSYQGHIFLAFSLDKKQRLDEAERIYDAAVTIRPQDAQAY
QGLIKLYQSQGANKLIEYQRAVINVARIFYDSEDLYKAQDAVDSYVDFARAHGDSLQYADALWIRLPESPLYPIL
EGRFPPPAKAYETIAHIIEDYDKKRINTLIGERRTRLAAVLSHVTTQVKREVYGQSKLEHIYRQLIDWTNNDELR
RCFEEKLLRYCHDRLLVCPPEAKAEQRAIVLKLAQDMVIIQHPFKLAWEIVINWQDHKEIKDWDVQLLRTYCSFF
PESDMYKVITAYLTSNLSPFPPAVDAEKKMPETSWSDESEDDDDGGVPTSYLPLSDEDRLIMITEGMSGAESTFS
YRLVGHFFLQLGEYETTVEQMRKARQFIAREQAVMGMQFQNTCDAYSVLLATALVYYQCPRHHEEAKSLFDGVLE
HDTSCTAALIGVGLIYEEEQELDQALDFLTRAIQRDGTNLRVRCEAAWVKALRGDWQTAKEDLTDCLRLLGEERS
PDKDLVAEIHYRLGTCIWNMDSSRQARKRRSGDCAYAHWLAALSSNMNHAPSYTSLGVFYSDYAKDKRRGRYSFQ
KALEMSSAEVLAAERLARSFAEDGDWDRVELVARRVVESGKVKPPPGSKRKGISWPLAALGVAELNKQEYHKSIV
SFQSALRLSPNDYHCWVGLGESYHSSGRYMAATKAIVNAQSLEQDGQGGEAQDGWFTTYMLANIKRELGEFDEAI
SLYQSVLDTRADEEGVVIALLQTLVENALASLERGHFGKSVELALKAIDFACGASASVRKTFNFWKSVGDACSVF
SSVQSQVQDFPKDSMRMLLESSNQEAFDVLSNVDQVDTSVVFAKGLYSQEEQVAVDLTRCVHASILCHKAAMHAA
QDDVHARAVAHYNLGWAEFRAHECLPADLRMGSSKYLRASCQAFKRAIELESGNSEFWNALGVVTSDMNPSVSQH
ALVRSLHLNERSPVAWTNLGTVALLSGDTKLAKEAYTKAQSADPEYAHAWIGQAFIALLSGGQAEARGLLTHAMS
IADASSLPTRRHYSACIFDHIAAAPPEMTVSWLVQPLLALNQVHSLRPHDFVSDHLAALLDERIGDTRHMVQRLE
ELCDRAQGDYESTSSAQSLAKLTVAKADLARAYLASGSNQKAVECGQAALVLSRHQGQEELGQDRRSRARLSANL
TVGLGYFHVGAHDEAEECFKAALDESHGNADATCLVAQALWAQGTDESREKARECLFEIMEKQPEHMHSILLLGI
MALVDQDEGSLEAVVEDLELLRATASVSAARQSQISQVLRAIAGLRQGHTEQDRLAQVQRDIMLHPYLAHGWGAL
AETTRSRHAAQMALVVSAQNMPPRGSIESVELAEAYARTGKAADGQRAALLAPWRPLDVTVQGQE*
Coding >OphauG2|6415
ATGGCACAGCTCAAGGCAGCGCTGAAGCTCATCAACGAGGCTATCCGACAGCACAAGTTCGACGACGCTATTCAA
AAGTCGCGCGAGTACTTGGCCAAGGACCCAAAGAGCTATCAAGGACATATTTTTCTTGCCTTTTCCCTCGATAAA
AAGCAACGGCTGGACGAGGCCGAGAGAATATACGATGCTGCTGTGACGATTCGTCCACAAGATGCTCAGGCCTAC
CAGGGATTGATCAAGCTCTACCAGTCGCAAGGCGCCAATAAGCTCATTGAGTATCAACGAGCCGTCATCAATGTA
GCCCGCATCTTTTACGATTCAGAGGATCTCTACAAAGCCCAGGACGCTGTTGATAGTTATGTCGACTTTGCTCGA
GCCCATGGCGACTCACTGCAATATGCCGACGCTTTATGGATTCGTCTCCCCGAAAGCCCTCTCTACCCCATACTC
GAGGGACGCTTTCCCCCTCCGGCCAAGGCGTACGAGACAATCGCCCATATTATTGAAGACTATGATAAGAAGCGT
ATCAACACTCTTATTGGCGAGCGCCGCACCCGTCTCGCTGCTGTTCTCAGCCATGTCACTACCCAAGTGAAGCGC
GAAGTCTATGGCCAGAGCAAGCTGGAGCACATCTACCGTCAGCTGATAGACTGGACCAACAACGATGAGTTGCGA
AGATGTTTTGAAGAGAAGCTACTACGCTATTGCCATGACCGCTTGCTTGTTTGTCCCCCAGAAGCCAAAGCTGAG
CAGCGAGCCATCGTTCTCAAGCTGGCGCAAGATATGGTCATCATTCAACATCCCTTCAAGCTGGCGTGGGAAATT
GTGATCAATTGGCAGGACCATAAGGAAATCAAGGATTGGGACGTGCAATTACTGCGCACTTACTGCTCCTTCTTC
CCTGAGAGTGATATGTACAAGGTCATCACGGCTTATCTTACGAGCAACCTGTCGCCGTTTCCCCCTGCAGTGGAT
GCGGAGAAAAAGATGCCAGAGACGTCTTGGAGTGATGAAAGCGAGGATGACGACGACGGAGGTGTTCCCACCTCA
TATCTTCCCCTCAGCGATGAGGATCGCCTCATCATGATTACCGAGGGCATGTCAGGGGCTGAATCAACATTTTCG
TACCGACTAGTTGGCCATTTTTTCCTTCAGCTTGGCGAATACGAGACGACTGTTGAACAGATGCGGAAAGCCCGT
CAATTTATAGCCCGGGAGCAGGCAGTAATGGGAATGCAATTCCAAAACACTTGCGATGCCTATTCAGTCCTTTTG
GCTACAGCCCTGGTATACTACCAATGCCCGCGACACCACGAGGAAGCCAAGAGCCTGTTTGATGGTGTGCTTGAG
CATGACACAAGCTGCACTGCCGCGCTGATAGGGGTTGGGCTCATCTATGAAGAGGAACAAGAATTGGACCAGGCC
CTGGATTTTCTGACCCGCGCCATCCAACGAGATGGCACGAATTTGCGAGTCCGATGCGAGGCGGCTTGGGTCAAG
GCTCTAAGGGGAGACTGGCAGACTGCAAAGGAAGATTTGACGGATTGCCTACGACTCCTCGGGGAGGAGCGGTCG
CCTGACAAGGACCTTGTCGCAGAAATACATTATCGCCTTGGGACATGCATCTGGAACATGGATAGCAGTCGCCAG
GCCCGAAAGCGGCGAAGCGGCGATTGTGCCTATGCTCACTGGTTGGCTGCTCTCAGCAGTAACATGAACCACGCC
CCATCCTACACAAGCCTGGGTGTTTTCTATAGCGATTATGCCAAGGACAAGAGGAGAGGCCGCTACTCCTTCCAG
AAGGCGCTCGAGATGTCGTCGGCCGAGGTGCTGGCAGCAGAACGGCTGGCGCGCTCGTTTGCCGAAGATGGCGAC
TGGGACCGAGTCGAGCTGGTGGCCAGACGTGTTGTCGAATCTGGCAAGGTAAAGCCACCGCCAGGATCCAAGCGA
AAAGGTATAAGCTGGCCCTTGGCGGCATTGGGCGTCGCCGAGCTTAACAAGCAGGAATATCACAAGTCGATTGTG
TCTTTCCAATCGGCCCTCAGGCTGTCTCCAAACGACTACCACTGTTGGGTCGGTCTCGGCGAAAGCTATCATAGC
TCTGGCAGGTACATGGCAGCAACAAAAGCCATTGTAAACGCGCAAAGCTTGGAGCAAGACGGCCAAGGCGGCGAG
GCGCAGGATGGCTGGTTCACTACCTACATGCTGGCCAACATTAAGCGGGAACTGGGAGAATTCGACGAGGCAATA
TCTCTCTACCAGTCTGTGCTGGACACGCGGGCAGACGAGGAGGGAGTCGTTATTGCCCTGTTGCAGACATTGGTG
GAAAACGCGCTGGCCAGTCTAGAACGAGGCCACTTTGGCAAGAGTGTTGAGTTGGCTCTCAAGGCCATTGATTTT
GCGTGTGGAGCGAGCGCAAGTGTCAGGAAAACATTTAATTTTTGGAAGAGCGTGGGCGATGCATGCTCCGTCTTT
TCCAGCGTTCAAAGTCAGGTCCAAGACTTTCCCAAGGATTCAATGAGGATGCTTTTGGAAAGCAGCAACCAAGAG
GCCTTTGATGTATTGAGCAACGTGGACCAGGTTGACACAAGCGTTGTCTTTGCCAAAGGGCTGTACTCGCAGGAG
GAGCAGGTGGCGGTGGACTTGACGCGCTGTGTGCACGCATCAATTCTCTGCCACAAGGCGGCCATGCACGCGGCC
CAAGACGACGTGCACGCGCGGGCTGTGGCCCATTATAACCTGGGATGGGCCGAGTTCAGAGCCCACGAGTGTCTG
CCAGCCGACTTGAGAATGGGCTCGAGCAAGTACCTGAGAGCATCGTGCCAGGCATTCAAGAGGGCAATCGAGCTG
GAGAGCGGCAACTCGGAGTTTTGGAACGCGCTGGGCGTGGTGACGAGCGACATGAACCCAAGCGTGTCCCAGCAC
GCCTTGGTCAGAAGCCTGCACCTCAACGAGCGCAGCCCTGTGGCTTGGACCAATCTGGGCACTGTGGCCCTGCTG
TCTGGAGACACCAAGCTGGCCAAGGAGGCCTACACAAAGGCACAGTCGGCAGATCCTGAATATGCACATGCATGG
ATTGGCCAGGCATTCATTGCGCTGCTCAGCGGCGGCCAAGCAGAAGCCAGGGGGCTTTTGACGCATGCCATGAGC
ATCGCCGACGCTTCATCACTGCCGACGCGCCGCCATTACTCGGCCTGCATCTTTGACCACATTGCCGCGGCGCCG
CCCGAAATGACTGTATCATGGCTGGTCCAGCCCTTGCTGGCGCTCAATCAGGTGCACAGTCTCCGGCCACACGAC
TTTGTCTCTGACCACTTGGCGGCGCTGCTGGACGAACGCATTGGCGACACGCGTCACATGGTGCAGAGGCTGGAG
GAGCTGTGCGATAGGGCCCAAGGCGACTATGAATCGACGTCGTCTGCCCAGAGTCTGGCCAAGCTGACAGTGGCC
AAGGCTGACCTGGCCAGGGCCTACCTTGCAAGCGGCTCCAACCAAAAGGCTGTGGAATGCGGCCAAGCAGCGCTG
GTGCTCAGCAGACATCAAGGCCAAGAGGAGCTTGGCCAAGATAGACGATCAAGGGCCAGGCTTTCGGCAAACCTG
ACGGTCGGTCTGGGCTATTTCCATGTCGGCGCGCACGATGAGGCAGAAGAGTGTTTCAAGGCGGCTCTCGACGAG
TCGCATGGCAACGCAGACGCCACATGCCTTGTGGCGCAGGCACTTTGGGCCCAAGGCACCGACGAGTCGCGTGAA
AAGGCGCGCGAGTGTCTCTTTGAGATTATGGAGAAGCAGCCGGAGCACATGCACAGCATATTGCTGCTTGGAATC
ATGGCTCTTGTGGACCAGGACGAGGGCAGTCTAGAGGCAGTGGTGGAAGACCTCGAACTGCTGCGCGCCACTGCC
TCGGTGTCGGCCGCAAGACAGTCACAGATAAGCCAAGTGCTGCGTGCCATTGCCGGCTTGAGACAGGGGCACACG
GAGCAGGACAGGCTGGCGCAGGTGCAGCGCGACATTATGCTCCACCCATATCTGGCCCATGGCTGGGGCGCGCTG
GCCGAGACGACACGCAGCCGACACGCAGCACAGATGGCACTGGTTGTGTCGGCGCAAAACATGCCACCGCGCGGG
TCAATCGAGTCTGTGGAGCTCGCCGAGGCGTATGCGAGGACGGGTAAAGCTGCCGATGGGCAGAGAGCGGCACTG
CTCGCTCCGTGGCGCCCGCTCGACGTGACTGTGCAAGGACAGGAATAG
Transcript >OphauG2|6415
ATGGCACAGCTCAAGGCAGCGCTGAAGCTCATCAACGAGGCTATCCGACAGCACAAGTTCGACGACGCTATTCAA
AAGTCGCGCGAGTACTTGGCCAAGGACCCAAAGAGCTATCAAGGACATATTTTTCTTGCCTTTTCCCTCGATAAA
AAGCAACGGCTGGACGAGGCCGAGAGAATATACGATGCTGCTGTGACGATTCGTCCACAAGATGCTCAGGCCTAC
CAGGGATTGATCAAGCTCTACCAGTCGCAAGGCGCCAATAAGCTCATTGAGTATCAACGAGCCGTCATCAATGTA
GCCCGCATCTTTTACGATTCAGAGGATCTCTACAAAGCCCAGGACGCTGTTGATAGTTATGTCGACTTTGCTCGA
GCCCATGGCGACTCACTGCAATATGCCGACGCTTTATGGATTCGTCTCCCCGAAAGCCCTCTCTACCCCATACTC
GAGGGACGCTTTCCCCCTCCGGCCAAGGCGTACGAGACAATCGCCCATATTATTGAAGACTATGATAAGAAGCGT
ATCAACACTCTTATTGGCGAGCGCCGCACCCGTCTCGCTGCTGTTCTCAGCCATGTCACTACCCAAGTGAAGCGC
GAAGTCTATGGCCAGAGCAAGCTGGAGCACATCTACCGTCAGCTGATAGACTGGACCAACAACGATGAGTTGCGA
AGATGTTTTGAAGAGAAGCTACTACGCTATTGCCATGACCGCTTGCTTGTTTGTCCCCCAGAAGCCAAAGCTGAG
CAGCGAGCCATCGTTCTCAAGCTGGCGCAAGATATGGTCATCATTCAACATCCCTTCAAGCTGGCGTGGGAAATT
GTGATCAATTGGCAGGACCATAAGGAAATCAAGGATTGGGACGTGCAATTACTGCGCACTTACTGCTCCTTCTTC
CCTGAGAGTGATATGTACAAGGTCATCACGGCTTATCTTACGAGCAACCTGTCGCCGTTTCCCCCTGCAGTGGAT
GCGGAGAAAAAGATGCCAGAGACGTCTTGGAGTGATGAAAGCGAGGATGACGACGACGGAGGTGTTCCCACCTCA
TATCTTCCCCTCAGCGATGAGGATCGCCTCATCATGATTACCGAGGGCATGTCAGGGGCTGAATCAACATTTTCG
TACCGACTAGTTGGCCATTTTTTCCTTCAGCTTGGCGAATACGAGACGACTGTTGAACAGATGCGGAAAGCCCGT
CAATTTATAGCCCGGGAGCAGGCAGTAATGGGAATGCAATTCCAAAACACTTGCGATGCCTATTCAGTCCTTTTG
GCTACAGCCCTGGTATACTACCAATGCCCGCGACACCACGAGGAAGCCAAGAGCCTGTTTGATGGTGTGCTTGAG
CATGACACAAGCTGCACTGCCGCGCTGATAGGGGTTGGGCTCATCTATGAAGAGGAACAAGAATTGGACCAGGCC
CTGGATTTTCTGACCCGCGCCATCCAACGAGATGGCACGAATTTGCGAGTCCGATGCGAGGCGGCTTGGGTCAAG
GCTCTAAGGGGAGACTGGCAGACTGCAAAGGAAGATTTGACGGATTGCCTACGACTCCTCGGGGAGGAGCGGTCG
CCTGACAAGGACCTTGTCGCAGAAATACATTATCGCCTTGGGACATGCATCTGGAACATGGATAGCAGTCGCCAG
GCCCGAAAGCGGCGAAGCGGCGATTGTGCCTATGCTCACTGGTTGGCTGCTCTCAGCAGTAACATGAACCACGCC
CCATCCTACACAAGCCTGGGTGTTTTCTATAGCGATTATGCCAAGGACAAGAGGAGAGGCCGCTACTCCTTCCAG
AAGGCGCTCGAGATGTCGTCGGCCGAGGTGCTGGCAGCAGAACGGCTGGCGCGCTCGTTTGCCGAAGATGGCGAC
TGGGACCGAGTCGAGCTGGTGGCCAGACGTGTTGTCGAATCTGGCAAGGTAAAGCCACCGCCAGGATCCAAGCGA
AAAGGTATAAGCTGGCCCTTGGCGGCATTGGGCGTCGCCGAGCTTAACAAGCAGGAATATCACAAGTCGATTGTG
TCTTTCCAATCGGCCCTCAGGCTGTCTCCAAACGACTACCACTGTTGGGTCGGTCTCGGCGAAAGCTATCATAGC
TCTGGCAGGTACATGGCAGCAACAAAAGCCATTGTAAACGCGCAAAGCTTGGAGCAAGACGGCCAAGGCGGCGAG
GCGCAGGATGGCTGGTTCACTACCTACATGCTGGCCAACATTAAGCGGGAACTGGGAGAATTCGACGAGGCAATA
TCTCTCTACCAGTCTGTGCTGGACACGCGGGCAGACGAGGAGGGAGTCGTTATTGCCCTGTTGCAGACATTGGTG
GAAAACGCGCTGGCCAGTCTAGAACGAGGCCACTTTGGCAAGAGTGTTGAGTTGGCTCTCAAGGCCATTGATTTT
GCGTGTGGAGCGAGCGCAAGTGTCAGGAAAACATTTAATTTTTGGAAGAGCGTGGGCGATGCATGCTCCGTCTTT
TCCAGCGTTCAAAGTCAGGTCCAAGACTTTCCCAAGGATTCAATGAGGATGCTTTTGGAAAGCAGCAACCAAGAG
GCCTTTGATGTATTGAGCAACGTGGACCAGGTTGACACAAGCGTTGTCTTTGCCAAAGGGCTGTACTCGCAGGAG
GAGCAGGTGGCGGTGGACTTGACGCGCTGTGTGCACGCATCAATTCTCTGCCACAAGGCGGCCATGCACGCGGCC
CAAGACGACGTGCACGCGCGGGCTGTGGCCCATTATAACCTGGGATGGGCCGAGTTCAGAGCCCACGAGTGTCTG
CCAGCCGACTTGAGAATGGGCTCGAGCAAGTACCTGAGAGCATCGTGCCAGGCATTCAAGAGGGCAATCGAGCTG
GAGAGCGGCAACTCGGAGTTTTGGAACGCGCTGGGCGTGGTGACGAGCGACATGAACCCAAGCGTGTCCCAGCAC
GCCTTGGTCAGAAGCCTGCACCTCAACGAGCGCAGCCCTGTGGCTTGGACCAATCTGGGCACTGTGGCCCTGCTG
TCTGGAGACACCAAGCTGGCCAAGGAGGCCTACACAAAGGCACAGTCGGCAGATCCTGAATATGCACATGCATGG
ATTGGCCAGGCATTCATTGCGCTGCTCAGCGGCGGCCAAGCAGAAGCCAGGGGGCTTTTGACGCATGCCATGAGC
ATCGCCGACGCTTCATCACTGCCGACGCGCCGCCATTACTCGGCCTGCATCTTTGACCACATTGCCGCGGCGCCG
CCCGAAATGACTGTATCATGGCTGGTCCAGCCCTTGCTGGCGCTCAATCAGGTGCACAGTCTCCGGCCACACGAC
TTTGTCTCTGACCACTTGGCGGCGCTGCTGGACGAACGCATTGGCGACACGCGTCACATGGTGCAGAGGCTGGAG
GAGCTGTGCGATAGGGCCCAAGGCGACTATGAATCGACGTCGTCTGCCCAGAGTCTGGCCAAGCTGACAGTGGCC
AAGGCTGACCTGGCCAGGGCCTACCTTGCAAGCGGCTCCAACCAAAAGGCTGTGGAATGCGGCCAAGCAGCGCTG
GTGCTCAGCAGACATCAAGGCCAAGAGGAGCTTGGCCAAGATAGACGATCAAGGGCCAGGCTTTCGGCAAACCTG
ACGGTCGGTCTGGGCTATTTCCATGTCGGCGCGCACGATGAGGCAGAAGAGTGTTTCAAGGCGGCTCTCGACGAG
TCGCATGGCAACGCAGACGCCACATGCCTTGTGGCGCAGGCACTTTGGGCCCAAGGCACCGACGAGTCGCGTGAA
AAGGCGCGCGAGTGTCTCTTTGAGATTATGGAGAAGCAGCCGGAGCACATGCACAGCATATTGCTGCTTGGAATC
ATGGCTCTTGTGGACCAGGACGAGGGCAGTCTAGAGGCAGTGGTGGAAGACCTCGAACTGCTGCGCGCCACTGCC
TCGGTGTCGGCCGCAAGACAGTCACAGATAAGCCAAGTGCTGCGTGCCATTGCCGGCTTGAGACAGGGGCACACG
GAGCAGGACAGGCTGGCGCAGGTGCAGCGCGACATTATGCTCCACCCATATCTGGCCCATGGCTGGGGCGCGCTG
GCCGAGACGACACGCAGCCGACACGCAGCACAGATGGCACTGGTTGTGTCGGCGCAAAACATGCCACCGCGCGGG
TCAATCGAGTCTGTGGAGCTCGCCGAGGCGTATGCGAGGACGGGTAAAGCTGCCGATGGGCAGAGAGCGGCACTG
CTCGCTCCGTGGCGCCCGCTCGACGTGACTGTGCAAGGACAGGAATAG
Gene >OphauG2|6415
ATGGCACAGCTCAAGGCAGCGCTGAAGCTCATCAACGAGGCTATCCGACAGCACAAGTTCGACGACGCTATTCAA
AAGTCGCGCGAGTACTTGGCCAAGGACCCAAAGAGCTATCAAGGGTACGTATGTGCCGTATATTATTTATTGATG
GGCATCCGCGTTTGCACGGCAGAAGGAAGAAAATAACACGCGTCGCAGACATATTTTTCTTGCCTTTTCCCTCGA
TAAAAAGCAACGGCTGGACGAGGCCGAGAGAATATACGATGCTGCTGTGACGATTCGTCCACAAGATGCTCAGGC
CTACCAGGGATTGATCAAGCTCTACCAGTCGCAAGGCGCCAATAAGCTCATTGAGTATCAACGAGCCGTCATCAA
TGTAGCCCGCATCTTTTACGATTCAGAGGATCTCTACAAAGCCCAGGACGCTGTTGATAGTTATGTCGACTTTGC
TCGAGCCCATGGCGACTCACTGCAATATGCCGACGCTTTATGGATTCGTCTCCCCGAAAGCCCTCTCTACCCCAT
ACTCGAGGGACGCTTTCCCCCTCCGGCCAAGGCGTACGAGACAATCGCCCATATTATTGAAGACTATGATAAGAA
GCGTATCAACACTCTTATTGGCGAGCGCCGCACCCGTCTCGCTGCTGTTCTCAGCCATGTCACTACCCAAGTGAA
GCGCGAAGTCTATGGCCAGAGCAAGCTGGAGCACATCTACCGTCAGCTGATAGACTGGACCAACAACGATGAGTT
GCGAAGATGTTTTGAAGAGAAGCTACTACGCTATTGCCATGACCGCTTGCTTGTTTGTCCCCCAGAAGCCAAAGC
TGAGCAGCGAGCCATCGTTCTCAAGCTGGCGCAAGATATGGTCATCATTCAACATCCCTTCAAGCTGGCGTGGGA
AATTGTGATCAATTGGCAGGACCATAAGGAAATCAAGGATTGGGACGTGCAATTACTGCGCACTTACTGCTCCTT
CTTCCCTGAGAGTGATATGTACAAGGTCATCACGGCTTATCTTACGAGCAACCTGTCGCCGTTTCCCCCTGCAGT
GGATGCGGAGAAAAAGATGCCAGAGACGTCTTGGAGTGATGAAAGCGAGGATGACGACGACGGAGGTGTTCCCAC
CTCATATCTTCCCCTCAGCGATGAGGATCGCCTCATCATGATTACCGAGGGCATGTCAGGGGCTGAATCAACATT
TTCGTACCGACTAGTTGGCCATTTTTTCCTTCAGCTTGGCGAATACGAGACGACTGTTGAACAGATGCGGAAAGC
CCGTCAATTTATAGCCCGGGAGCAGGCAGTAATGGGAATGCAATTCCAAAACACTTGCGATGCCTATTCAGTCCT
TTTGGCTACAGCCCTGGTATACTACCAATGCCCGCGACACCACGAGGAAGCCAAGAGCCTGTTTGATGGTGTGCT
TGAGCATGACACAAGCTGCACTGCCGCGCTGATAGGGGTTGGGCTCATCTATGAAGAGGAACAAGAATTGGACCA
GGCCCTGGATTTTCTGACCCGCGCCATCCAACGAGATGGCACGAATTTGCGAGTCCGATGCGAGGCGGCTTGGGT
CAAGGCTCTAAGGGGAGACTGGCAGACTGCAAAGGAAGATTTGACGGATTGCCTACGACTCCTCGGGGAGGAGCG
GTCGCCTGACAAGGACCTTGTCGCAGAAATACATTATCGCCTTGGGACATGCATCTGGAACATGGATAGCAGTCG
CCAGGCCCGAAAGCGGCGAAGCGGCGATTGTGCCTATGCTCACTGGTTGGCTGCTCTCAGCAGTAACATGAACCA
CGCCCCATCCTACACAAGCCTGGGTGTTTTCTATAGCGATTATGCCAAGGACAAGAGGAGAGGCCGCTACTCCTT
CCAGAAGGCGCTCGAGATGTCGTCGGCCGAGGTGCTGGCAGCAGAACGGCTGGCGCGCTCGTTTGCCGAAGATGG
CGACTGGGACCGAGTCGAGCTGGTGGCCAGACGTGTTGTCGAATCTGGCAAGGTAAAGCCACCGCCAGGATCCAA
GCGAAAAGGTATAAGCTGGCCCTTGGCGGCATTGGGCGTCGCCGAGCTTAACAAGCAGGAATATCACAAGTCGAT
TGTGTCTTTCCAATCGGCCCTCAGGCTGTCTCCAAACGACTACCACTGTTGGGTCGGTCTCGGCGAAAGCTATCA
TAGCTCTGGCAGGTACATGGCAGCAACAAAAGCCATTGTAAACGCGCAAAGCTTGGAGCAAGACGGCCAAGGCGG
CGAGGCGCAGGATGGCTGGTTCACTACCTACATGCTGGCCAACATTAAGCGGGAACTGGGAGAATTCGACGAGGC
AATATCTCTCTACCAGTCTGTGCTGGACACGCGGGCAGACGAGGAGGGAGTCGTTATTGCCCTGTTGCAGACATT
GGTGGAAAACGCGCTGGCCAGTCTAGAACGAGGCCACTTTGGCAAGAGTGTTGAGTTGGCTCTCAAGGCCATTGA
TTTTGCGTGTGGAGCGAGCGCAAGTGTCAGGAAAACATTTAATTTTTGGAAGAGCGTGGGCGATGCATGCTCCGT
CTTTTCCAGCGTTCAAAGTCAGGTCCAAGACTTTCCCAAGGATTCAATGAGGATGCTTTTGGAAAGCAGCAACCA
AGAGGCCTTTGATGTATTGAGCAACGTGGACCAGGTTGACACAAGCGTTGTCTTTGCCAAAGGGCTGTACTCGCA
GGAGGAGCAGGTGGCGGTGGACTTGACGCGCTGTGTGCACGCATCAATTCTCTGCCACAAGGCGGCCATGCACGC
GGCCCAAGACGACGTGCACGCGCGGGCTGTGGCCCATTATAACCTGGGATGGGCCGAGTTCAGAGCCCACGAGTG
TCTGCCAGCCGACTTGAGAATGGGCTCGAGCAAGTACCTGAGAGCATCGTGCCAGGCATTCAAGAGGGCAATCGA
GCTGGAGAGCGGCAACTCGGAGTTTTGGAACGCGCTGGGCGTGGTGACGAGCGACATGAACCCAAGCGTGTCCCA
GCACGCCTTGGTCAGAAGCCTGCACCTCAACGAGCGCAGCCCTGTGGCTTGGACCAATCTGGGCACTGTGGCCCT
GCTGTCTGGAGACACCAAGCTGGCCAAGGAGGCCTACACAAAGGCACAGTCGGCAGATCCTGAATATGCACATGC
ATGGATTGGCCAGGCATTCATTGCGCTGCTCAGCGGCGGCCAAGCAGAAGCCAGGGGGCTTTTGACGCATGCCAT
GAGCATCGCCGACGCTTCATCACTGCCGACGCGCCGCCATTACTCGGCCTGCATCTTTGACCACATTGCCGCGGC
GCCGCCCGAAATGACTGTATCATGGCTGGTCCAGCCCTTGCTGGCGCTCAATCAGGTGCACAGTCTCCGGCCACA
CGACTTTGTCTCTGACCACTTGGCGGCGCTGCTGGACGAACGCATTGGCGACACGCGTCACATGGTGCAGAGGCT
GGAGGAGCTGTGCGATAGGGCCCAAGGCGACTATGAATCGACGTCGTCTGCCCAGAGTCTGGCCAAGCTGACAGT
GGCCAAGGCTGACCTGGCCAGGGCCTACCTTGCAAGCGGCTCCAACCAAAAGGCTGTGGAATGCGGCCAAGCAGC
GCTGGTGCTCAGCAGACATCAAGGCCAAGAGGAGCTTGGCCAAGATAGACGATCAAGGGCCAGGCTTTCGGCAAA
CCTGACGGTCGGTCTGGGCTATTTCCATGTCGGCGCGCACGATGAGGCAGAAGAGTGTTTCAAGGCGGCTCTCGA
CGAGTCGCATGGCAACGCAGACGCCACATGCCTTGTGGCGCAGGCACTTTGGGCCCAAGGCACCGACGAGTCGCG
TGAAAAGGCGCGCGAGTGTCTCTTTGAGATTATGGAGAAGCAGCCGGAGCACATGCACAGCATATTGCTGCTTGG
AATCATGGCTCTTGTGGACCAGGACGAGGGCAGTCTAGAGGCAGTGGTGGAAGACCTCGAACTGCTGCGCGCCAC
TGCCTCGGTGTCGGCCGCAAGACAGTCACAGATAAGCCAAGTGCTGCGTGCCATTGCCGGCTTGAGACAGGGGCA
CACGGAGCAGGACAGGCTGGCGCAGGTGCAGCGCGACATTATGCTCCACCCATATCTGGCCCATGGCTGGGGCGC
GCTGGCCGAGACGACACGCAGCCGACACGCAGCACAGATGGCACTGGTTGTGTCGGCGCAAAACATGCCACCGCG
CGGGTCAATCGAGTCTGTGGAGCTCGCCGAGGCGTATGCGAGGACGGGTAAAGCTGCCGATGGGCAGAGAGCGGC
ACTGCTCGCTCCGTGGCGCCCGCTCGACGTGACTGTGCAAGGACAGGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail