Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6413
Gene name
LocationContig_66:14495..16784
Strand-
Gene length (bp)2289
Transcript length (bp)2289
Coding sequence length (bp)2289
Protein length (aa) 763

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18564 Glyco_hydro_5_C Glycoside hydrolase family 5 C-terminal domain 1.4E-20 638 727
PF00150 Cellulase Cellulase (glycosyl hydrolase family 5) 5.0E-07 63 251

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P40566|YIS7_YEAST Uncharacterized glycosyl hydrolase YIR007W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIR007W PE=1 SV=1 8 737 2.0E-167
sp|Q9GV16|EGCSE_CYANO Endoglycoceramidase OS=Cyanea nozakii PE=1 SV=1 10 195 7.0E-07

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0071704 organic substance metabolic process Yes
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6413
MFRLTIQDGQFRDNQGRQVVLRGINVAGDSKLPSEPYQPSHMAQGFFDGNKVSFHDRPFSKQDAPKHFARIRRYG
FNTIRYIFTWEAIEAAGPGIYDETFIQHTIEILRIAKGFGFYVFMDPHQDVWSRFTGGSGAPLWTIYACGLDPRC
FAATEAAIVHNTYPDPDNFPKMIWSTNYYRLAAGTIFTFFFAGNDFAPRCIIDGVNIQDYLQGHFIRACAHLAMR
LGEAGDILDQVVVGWESMNEPNRGMTGYADLSVIPKEHPLKKGTCPTMWQTLLTGMGRACEIDTWDMGNLGPYKT
GTKLVDPRGEIAWLSDDWNDSEYGWRRDPGWKLGECIWAQHGVWDPLTDTLLRRDYFERNPTTGKAIDYPEFTNT
YFMDFWRKYSKACRAQHKDCIMLMQYPTLEMPPQIKDTADDDALMAFTPHFYDGITLMTKHWNSTWNVDVVGVLR
GKYLHPVFAIRLGETAIRNCLRDQLAYLRQEGLDRMGRHPCILTEFGIPYDMDNKKAYKTGDYTSQSAALDANYF
GVEGSHIEGHCLWVYTTNNDHERGDQWNGEDLSVVSLDDKTPPVSALPKATGPDSSASSLMKHALRHGQGDENVT
PGNLGRTLTNASMSSQPSLKDPSLTNAPGYRAAEAFIRPTATVVAGDVISSGFDLRQCTYTLKVEAPRAAADDGP
TIVYIPEFHFPKDESEVTVTSGKWEMGLDEDEGPLLQRLRWWHGQGTQSLTIRGIVRRHNVPEGTAEEAGYLEQC
QHGLGVGGCAVM*
Coding >OphauG2|6413
ATGTTTCGCCTAACAATCCAAGACGGCCAGTTCCGCGACAACCAGGGCCGGCAGGTAGTGCTGCGTGGCATCAAT
GTTGCTGGCGACTCCAAGCTTCCTAGCGAGCCCTATCAGCCCTCGCATATGGCTCAGGGCTTCTTTGACGGCAAC
AAGGTGTCGTTCCATGACCGTCCCTTTAGCAAACAAGATGCTCCAAAGCATTTTGCACGCATCCGGCGCTACGGA
TTCAATACCATTCGCTATATTTTTACCTGGGAAGCTATCGAGGCTGCCGGGCCAGGCATATACGATGAGACCTTT
ATCCAACACACAATCGAAATCCTGCGCATAGCAAAAGGCTTTGGCTTCTATGTCTTTATGGATCCTCACCAGGAC
GTCTGGTCACGCTTCACTGGCGGCTCTGGGGCGCCGCTGTGGACTATTTATGCCTGCGGTCTCGACCCCCGATGC
TTTGCTGCTACTGAGGCGGCTATTGTACACAACACATATCCCGACCCGGACAACTTCCCCAAGATGATTTGGTCG
ACAAACTACTATCGGCTGGCCGCTGGCACCATCTTCACCTTTTTCTTTGCCGGCAACGACTTTGCGCCGAGGTGT
ATTATTGACGGGGTCAACATCCAGGACTACCTTCAAGGCCACTTTATCAGGGCCTGCGCGCATCTTGCAATGAGA
CTGGGCGAGGCGGGAGACATTCTGGACCAGGTAGTTGTTGGCTGGGAGAGCATGAATGAGCCGAACCGGGGCATG
ACGGGCTATGCTGATCTGTCAGTCATTCCCAAAGAGCACCCGCTCAAAAAGGGCACCTGTCCAACCATGTGGCAA
ACGCTTTTGACGGGCATGGGCCGGGCGTGTGAGATAGACACGTGGGACATGGGCAACCTGGGTCCCTACAAGACG
GGCACAAAACTGGTTGACCCGCGAGGCGAGATTGCCTGGCTGTCGGATGACTGGAATGACTCCGAGTACGGCTGG
AGGCGGGATCCCGGCTGGAAACTTGGCGAGTGTATTTGGGCTCAGCATGGCGTGTGGGACCCCTTGACGGATACT
TTGCTGCGGCGAGACTACTTTGAAAGGAATCCGACGACGGGCAAGGCCATTGACTACCCCGAGTTTACCAACACG
TACTTTATGGACTTTTGGAGGAAATACAGCAAAGCGTGCCGCGCCCAGCACAAGGACTGTATCATGCTGATGCAG
TATCCCACACTGGAAATGCCCCCACAGATCAAAGACACGGCAGACGACGACGCTCTCATGGCCTTCACCCCGCAC
TTTTACGACGGCATCACTCTGATGACGAAGCATTGGAACAGCACCTGGAACGTGGATGTGGTAGGGGTGCTGCGA
GGCAAATATCTGCACCCCGTGTTTGCCATCAGGTTGGGAGAGACAGCCATCCGCAACTGCCTGAGGGACCAGCTG
GCATATCTCAGACAAGAAGGTCTCGACCGGATGGGTAGGCATCCTTGCATTCTGACGGAATTCGGCATCCCCTAC
GACATGGACAACAAGAAGGCATATAAGACGGGCGACTATACGAGCCAGTCGGCAGCACTCGACGCCAACTATTTC
GGCGTCGAGGGTTCGCATATCGAGGGGCATTGCCTTTGGGTCTACACCACCAACAATGACCACGAGCGCGGAGAC
CAGTGGAATGGCGAGGATTTGTCCGTTGTGTCGCTGGACGACAAGACACCGCCTGTTTCTGCTTTGCCCAAGGCA
ACAGGGCCCGACAGCTCGGCATCGAGTCTGATGAAGCACGCGTTAAGACATGGGCAAGGCGACGAGAATGTGACG
CCTGGGAACCTCGGGCGCACGCTGACCAACGCGTCAATGAGCTCGCAGCCGTCGCTCAAGGACCCGTCACTCACC
AACGCGCCTGGGTATCGAGCAGCAGAGGCCTTTATCCGGCCGACAGCGACAGTAGTGGCGGGCGACGTGATTTCA
AGCGGTTTCGACCTGCGACAGTGCACCTACACGCTCAAGGTGGAAGCGCCAAGGGCGGCGGCCGACGATGGGCCG
ACGATTGTATACATACCCGAGTTCCATTTTCCCAAGGACGAGTCCGAGGTGACGGTGACGTCGGGGAAATGGGAA
ATGGGTCTGGACGAAGACGAGGGCCCACTGCTGCAGCGGCTGCGCTGGTGGCATGGACAGGGGACGCAGAGCCTG
ACGATCCGAGGCATTGTTCGGCGGCACAATGTGCCCGAGGGGACAGCAGAGGAAGCGGGCTACCTCGAACAATGC
CAGCATGGCTTGGGCGTTGGGGGCTGCGCCGTCATGTAG
Transcript >OphauG2|6413
ATGTTTCGCCTAACAATCCAAGACGGCCAGTTCCGCGACAACCAGGGCCGGCAGGTAGTGCTGCGTGGCATCAAT
GTTGCTGGCGACTCCAAGCTTCCTAGCGAGCCCTATCAGCCCTCGCATATGGCTCAGGGCTTCTTTGACGGCAAC
AAGGTGTCGTTCCATGACCGTCCCTTTAGCAAACAAGATGCTCCAAAGCATTTTGCACGCATCCGGCGCTACGGA
TTCAATACCATTCGCTATATTTTTACCTGGGAAGCTATCGAGGCTGCCGGGCCAGGCATATACGATGAGACCTTT
ATCCAACACACAATCGAAATCCTGCGCATAGCAAAAGGCTTTGGCTTCTATGTCTTTATGGATCCTCACCAGGAC
GTCTGGTCACGCTTCACTGGCGGCTCTGGGGCGCCGCTGTGGACTATTTATGCCTGCGGTCTCGACCCCCGATGC
TTTGCTGCTACTGAGGCGGCTATTGTACACAACACATATCCCGACCCGGACAACTTCCCCAAGATGATTTGGTCG
ACAAACTACTATCGGCTGGCCGCTGGCACCATCTTCACCTTTTTCTTTGCCGGCAACGACTTTGCGCCGAGGTGT
ATTATTGACGGGGTCAACATCCAGGACTACCTTCAAGGCCACTTTATCAGGGCCTGCGCGCATCTTGCAATGAGA
CTGGGCGAGGCGGGAGACATTCTGGACCAGGTAGTTGTTGGCTGGGAGAGCATGAATGAGCCGAACCGGGGCATG
ACGGGCTATGCTGATCTGTCAGTCATTCCCAAAGAGCACCCGCTCAAAAAGGGCACCTGTCCAACCATGTGGCAA
ACGCTTTTGACGGGCATGGGCCGGGCGTGTGAGATAGACACGTGGGACATGGGCAACCTGGGTCCCTACAAGACG
GGCACAAAACTGGTTGACCCGCGAGGCGAGATTGCCTGGCTGTCGGATGACTGGAATGACTCCGAGTACGGCTGG
AGGCGGGATCCCGGCTGGAAACTTGGCGAGTGTATTTGGGCTCAGCATGGCGTGTGGGACCCCTTGACGGATACT
TTGCTGCGGCGAGACTACTTTGAAAGGAATCCGACGACGGGCAAGGCCATTGACTACCCCGAGTTTACCAACACG
TACTTTATGGACTTTTGGAGGAAATACAGCAAAGCGTGCCGCGCCCAGCACAAGGACTGTATCATGCTGATGCAG
TATCCCACACTGGAAATGCCCCCACAGATCAAAGACACGGCAGACGACGACGCTCTCATGGCCTTCACCCCGCAC
TTTTACGACGGCATCACTCTGATGACGAAGCATTGGAACAGCACCTGGAACGTGGATGTGGTAGGGGTGCTGCGA
GGCAAATATCTGCACCCCGTGTTTGCCATCAGGTTGGGAGAGACAGCCATCCGCAACTGCCTGAGGGACCAGCTG
GCATATCTCAGACAAGAAGGTCTCGACCGGATGGGTAGGCATCCTTGCATTCTGACGGAATTCGGCATCCCCTAC
GACATGGACAACAAGAAGGCATATAAGACGGGCGACTATACGAGCCAGTCGGCAGCACTCGACGCCAACTATTTC
GGCGTCGAGGGTTCGCATATCGAGGGGCATTGCCTTTGGGTCTACACCACCAACAATGACCACGAGCGCGGAGAC
CAGTGGAATGGCGAGGATTTGTCCGTTGTGTCGCTGGACGACAAGACACCGCCTGTTTCTGCTTTGCCCAAGGCA
ACAGGGCCCGACAGCTCGGCATCGAGTCTGATGAAGCACGCGTTAAGACATGGGCAAGGCGACGAGAATGTGACG
CCTGGGAACCTCGGGCGCACGCTGACCAACGCGTCAATGAGCTCGCAGCCGTCGCTCAAGGACCCGTCACTCACC
AACGCGCCTGGGTATCGAGCAGCAGAGGCCTTTATCCGGCCGACAGCGACAGTAGTGGCGGGCGACGTGATTTCA
AGCGGTTTCGACCTGCGACAGTGCACCTACACGCTCAAGGTGGAAGCGCCAAGGGCGGCGGCCGACGATGGGCCG
ACGATTGTATACATACCCGAGTTCCATTTTCCCAAGGACGAGTCCGAGGTGACGGTGACGTCGGGGAAATGGGAA
ATGGGTCTGGACGAAGACGAGGGCCCACTGCTGCAGCGGCTGCGCTGGTGGCATGGACAGGGGACGCAGAGCCTG
ACGATCCGAGGCATTGTTCGGCGGCACAATGTGCCCGAGGGGACAGCAGAGGAAGCGGGCTACCTCGAACAATGC
CAGCATGGCTTGGGCGTTGGGGGCTGCGCCGTCATGTAG
Gene >OphauG2|6413
ATGTTTCGCCTAACAATCCAAGACGGCCAGTTCCGCGACAACCAGGGCCGGCAGGTAGTGCTGCGTGGCATCAAT
GTTGCTGGCGACTCCAAGCTTCCTAGCGAGCCCTATCAGCCCTCGCATATGGCTCAGGGCTTCTTTGACGGCAAC
AAGGTGTCGTTCCATGACCGTCCCTTTAGCAAACAAGATGCTCCAAAGCATTTTGCACGCATCCGGCGCTACGGA
TTCAATACCATTCGCTATATTTTTACCTGGGAAGCTATCGAGGCTGCCGGGCCAGGCATATACGATGAGACCTTT
ATCCAACACACAATCGAAATCCTGCGCATAGCAAAAGGCTTTGGCTTCTATGTCTTTATGGATCCTCACCAGGAC
GTCTGGTCACGCTTCACTGGCGGCTCTGGGGCGCCGCTGTGGACTATTTATGCCTGCGGTCTCGACCCCCGATGC
TTTGCTGCTACTGAGGCGGCTATTGTACACAACACATATCCCGACCCGGACAACTTCCCCAAGATGATTTGGTCG
ACAAACTACTATCGGCTGGCCGCTGGCACCATCTTCACCTTTTTCTTTGCCGGCAACGACTTTGCGCCGAGGTGT
ATTATTGACGGGGTCAACATCCAGGACTACCTTCAAGGCCACTTTATCAGGGCCTGCGCGCATCTTGCAATGAGA
CTGGGCGAGGCGGGAGACATTCTGGACCAGGTAGTTGTTGGCTGGGAGAGCATGAATGAGCCGAACCGGGGCATG
ACGGGCTATGCTGATCTGTCAGTCATTCCCAAAGAGCACCCGCTCAAAAAGGGCACCTGTCCAACCATGTGGCAA
ACGCTTTTGACGGGCATGGGCCGGGCGTGTGAGATAGACACGTGGGACATGGGCAACCTGGGTCCCTACAAGACG
GGCACAAAACTGGTTGACCCGCGAGGCGAGATTGCCTGGCTGTCGGATGACTGGAATGACTCCGAGTACGGCTGG
AGGCGGGATCCCGGCTGGAAACTTGGCGAGTGTATTTGGGCTCAGCATGGCGTGTGGGACCCCTTGACGGATACT
TTGCTGCGGCGAGACTACTTTGAAAGGAATCCGACGACGGGCAAGGCCATTGACTACCCCGAGTTTACCAACACG
TACTTTATGGACTTTTGGAGGAAATACAGCAAAGCGTGCCGCGCCCAGCACAAGGACTGTATCATGCTGATGCAG
TATCCCACACTGGAAATGCCCCCACAGATCAAAGACACGGCAGACGACGACGCTCTCATGGCCTTCACCCCGCAC
TTTTACGACGGCATCACTCTGATGACGAAGCATTGGAACAGCACCTGGAACGTGGATGTGGTAGGGGTGCTGCGA
GGCAAATATCTGCACCCCGTGTTTGCCATCAGGTTGGGAGAGACAGCCATCCGCAACTGCCTGAGGGACCAGCTG
GCATATCTCAGACAAGAAGGTCTCGACCGGATGGGTAGGCATCCTTGCATTCTGACGGAATTCGGCATCCCCTAC
GACATGGACAACAAGAAGGCATATAAGACGGGCGACTATACGAGCCAGTCGGCAGCACTCGACGCCAACTATTTC
GGCGTCGAGGGTTCGCATATCGAGGGGCATTGCCTTTGGGTCTACACCACCAACAATGACCACGAGCGCGGAGAC
CAGTGGAATGGCGAGGATTTGTCCGTTGTGTCGCTGGACGACAAGACACCGCCTGTTTCTGCTTTGCCCAAGGCA
ACAGGGCCCGACAGCTCGGCATCGAGTCTGATGAAGCACGCGTTAAGACATGGGCAAGGCGACGAGAATGTGACG
CCTGGGAACCTCGGGCGCACGCTGACCAACGCGTCAATGAGCTCGCAGCCGTCGCTCAAGGACCCGTCACTCACC
AACGCGCCTGGGTATCGAGCAGCAGAGGCCTTTATCCGGCCGACAGCGACAGTAGTGGCGGGCGACGTGATTTCA
AGCGGTTTCGACCTGCGACAGTGCACCTACACGCTCAAGGTGGAAGCGCCAAGGGCGGCGGCCGACGATGGGCCG
ACGATTGTATACATACCCGAGTTCCATTTTCCCAAGGACGAGTCCGAGGTGACGGTGACGTCGGGGAAATGGGAA
ATGGGTCTGGACGAAGACGAGGGCCCACTGCTGCAGCGGCTGCGCTGGTGGCATGGACAGGGGACGCAGAGCCTG
ACGATCCGAGGCATTGTTCGGCGGCACAATGTGCCCGAGGGGACAGCAGAGGAAGCGGGCTACCTCGAACAATGC
CAGCATGGCTTGGGCGTTGGGGGCTGCGCCGTCATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail