Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6404
Gene name
LocationContig_659:3366..4029
Strand+
Gene length (bp)663
Transcript length (bp)513
Coding sequence length (bp)513
Protein length (aa) 171

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06766 Hydrophobin_2 Fungal hydrophobin 4.2E-21 104 168

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P52753|CRYP_CRYPA Cryparin OS=Cryphonectria parasitica GN=CRP PE=1 SV=1 107 168 3.0E-11
sp|Q9UVI4|THYD_CLAFS Trihydrophobin OS=Claviceps fusiformis GN=TH1 PE=1 SV=1 104 170 6.0E-10
sp|P52754|HYP1_HYPJE Hydrophobin-1 OS=Hypocrea jecorina GN=hfb1 PE=1 SV=1 91 170 3.0E-09
sp|Q9UVI4|THYD_CLAFS Trihydrophobin OS=Claviceps fusiformis GN=TH1 PE=1 SV=1 104 166 2.0E-08
sp|Q9UVI4|THYD_CLAFS Trihydrophobin OS=Claviceps fusiformis GN=TH1 PE=1 SV=1 104 170 3.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P52753|CRYP_CRYPA Cryparin OS=Cryphonectria parasitica GN=CRP PE=1 SV=1 107 168 3.0E-11
sp|Q9UVI4|THYD_CLAFS Trihydrophobin OS=Claviceps fusiformis GN=TH1 PE=1 SV=1 104 170 6.0E-10
sp|P52754|HYP1_HYPJE Hydrophobin-1 OS=Hypocrea jecorina GN=hfb1 PE=1 SV=1 91 170 3.0E-09
sp|Q9UVI4|THYD_CLAFS Trihydrophobin OS=Claviceps fusiformis GN=TH1 PE=1 SV=1 104 166 2.0E-08
sp|Q9UVI4|THYD_CLAFS Trihydrophobin OS=Claviceps fusiformis GN=TH1 PE=1 SV=1 104 170 3.0E-08
sp|P52755|QID3_TRIHA Cell wall protein qid3 OS=Trichoderma harzianum GN=qid3 PE=2 SV=1 103 168 1.0E-07
sp|P79073|HYP2_HYPJE Hydrophobin-2 OS=Hypocrea jecorina GN=hfb2 PE=1 SV=1 104 170 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005576 extracellular region Yes
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 21 0.999737

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7751
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6404 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1428

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6404
MKPFAIAALVALAAAVPSGQAKNGGYYPVDPYGSVYDGHSGSGNGNGGAGNGNGGDWTPVKPGGDGGNGNGSGDG
NGGNGNGGNGNGNGDNNGSGNVPSIDDFCPRSGLVGNPFCCTTDVLNLLDLRCEIPTQPFSSLTSLKQICQDEGR
EARCCAIPLIGQGVICEDTL*
Coding >OphauG2|6404
ATGAAGCCGTTTGCCATTGCTGCTCTTGTGGCTCTTGCCGCGGCCGTGCCTTCTGGCCAGGCCAAGAATGGAGGC
TACTATCCTGTTGACCCCTATGGCTCTGTGTACGACGGCCACTCGGGCTCTGGCAATGGCAACGGCGGCGCTGGC
AATGGCAACGGCGGCGACTGGACCCCAGTGAAGCCTGGGGGCGATGGCGGCAACGGAAATGGCAGTGGTGATGGC
AATGGCGGCAATGGCAATGGCGGCAACGGCAATGGCAATGGCGACAACAATGGCAGTGGCAACGTTCCCAGCATT
GATGACTTTTGCCCTCGAAGCGGCCTTGTGGGCAACCCTTTTTGCTGCACTACAGATGTCCTCAACTTGCTCGAT
CTTCGATGCGAGATTCCCACGCAACCCTTTTCCAGCCTGACTTCGCTCAAGCAAATCTGCCAAGATGAAGGCCGA
GAGGCCAGATGCTGCGCCATCCCTCTTATTGGCCAGGGCGTGATCTGCGAAGACACTCTCTAA
Transcript >OphauG2|6404
ATGAAGCCGTTTGCCATTGCTGCTCTTGTGGCTCTTGCCGCGGCCGTGCCTTCTGGCCAGGCCAAGAATGGAGGC
TACTATCCTGTTGACCCCTATGGCTCTGTGTACGACGGCCACTCGGGCTCTGGCAATGGCAACGGCGGCGCTGGC
AATGGCAACGGCGGCGACTGGACCCCAGTGAAGCCTGGGGGCGATGGCGGCAACGGAAATGGCAGTGGTGATGGC
AATGGCGGCAATGGCAATGGCGGCAACGGCAATGGCAATGGCGACAACAATGGCAGTGGCAACGTTCCCAGCATT
GATGACTTTTGCCCTCGAAGCGGCCTTGTGGGCAACCCTTTTTGCTGCACTACAGATGTCCTCAACTTGCTCGAT
CTTCGATGCGAGATTCCCACGCAACCCTTTTCCAGCCTGACTTCGCTCAAGCAAATCTGCCAAGATGAAGGCCGA
GAGGCCAGATGCTGCGCCATCCCTCTTATTGGCCAGGGCGTGATCTGCGAAGACACTCTCTAA
Gene >OphauG2|6404
ATGAAGCCGTTTGCCATTGCTGCTCTTGTGGCTCTTGCCGCGGCCGTGCCTTCTGGCCAGGCCAAGAATGGAGGC
TACTATCCTGTTGACCCCTATGGCTCTGTGTACGACGGCCACTCGGGCTCTGGCAATGGCAACGGCGGCGCTGGC
AATGGCAACGGCGGCGACTGGACCCCAGTGAAGCCTGGGGGCGATGGCGGCAACGGAAATGGCAGTGGTGATGGC
AATGGCGGCAATGGCAATGGCGGCAACGGCAATGGCAATGGCGACAACAATGGCAGTGGCAACGTTCCCAGCATT
GATGACTTTTGCCCTCGAAGCGGCCTTGTGGGCAACCCTTTTTGCTGCACTACAGATGTCCTCAACTTGCTCGAT
CTTCGATGCGAGATTCGTACGTCCTTTTTCCCTCTTTTTCTCTGCTTCTTGTTGGTTTCCTCACCTCCAGGAATG
CACATGCTAATGTGCCACATCTAGCCACGCAACCCTTTTCCAGCCTGACTTCGCTCAAGCAAATCTGCCAAGATG
AAGGCCGAGAGGCCAGATGCTGCGCCATCCCTCTTGTAAGTGCCATCTTGAAGTTTGCTGATGACCAAAAAAATG
ACTCGACTAACCTATTTGTCTTAACAGATTGGCCAGGGCGTGATCTGCGAAGACACTCTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail