Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6401
Gene name
LocationContig_658:6321..7806
Strand+
Gene length (bp)1485
Transcript length (bp)1362
Coding sequence length (bp)1362
Protein length (aa) 454

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16653 Sacchrp_dh_C Saccharopine dehydrogenase C-terminal domain 1.2E-95 130 445
PF03435 Sacchrp_dh_NADP Saccharopine dehydrogenase NADP binding domain 5.6E-23 7 126

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P4R4|LYS9_MAGO7 Saccharopine dehydrogenase [NADP(+), L-glutamate-forming] OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=LYS3 PE=1 SV=2 4 452 0.0E+00
sp|P38999|LYS9_YEAST Saccharopine dehydrogenase [NADP(+), L-glutamate-forming] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS9 PE=1 SV=1 5 452 0.0E+00
sp|O59711|LYS9_SCHPO Saccharopine dehydrogenase [NADP(+), L-glutamate-forming] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys9 PE=3 SV=1 6 452 0.0E+00
sp|A8E657|AASS_BOVIN Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Bos taurus GN=AASS PE=2 SV=1 1 440 4.0E-100
sp|Q9UDR5|AASS_HUMAN Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Homo sapiens GN=AASS PE=1 SV=1 1 452 1.0E-96
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P4R4|LYS9_MAGO7 Saccharopine dehydrogenase [NADP(+), L-glutamate-forming] OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=LYS3 PE=1 SV=2 4 452 0.0E+00
sp|P38999|LYS9_YEAST Saccharopine dehydrogenase [NADP(+), L-glutamate-forming] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS9 PE=1 SV=1 5 452 0.0E+00
sp|O59711|LYS9_SCHPO Saccharopine dehydrogenase [NADP(+), L-glutamate-forming] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys9 PE=3 SV=1 6 452 0.0E+00
sp|A8E657|AASS_BOVIN Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Bos taurus GN=AASS PE=2 SV=1 1 440 4.0E-100
sp|Q9UDR5|AASS_HUMAN Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Homo sapiens GN=AASS PE=1 SV=1 1 452 1.0E-96
sp|Q99K67|AASS_MOUSE Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Mus musculus GN=Aass PE=1 SV=1 1 440 3.0E-95
sp|A2VCW9|AASS_RAT Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Rattus norvegicus GN=Aass PE=2 SV=1 1 440 5.0E-93
sp|Q54NG9|SCPDH_DICDI Probable saccharopine dehydrogenase [NADP(+), L-glutamate-forming] OS=Dictyostelium discoideum GN=sdh PE=2 SV=1 5 449 2.0E-89
sp|Q9SMZ4|AASS_ARATH Alpha-aminoadipic semialdehyde synthase OS=Arabidopsis thaliana GN=LKR/SDH PE=1 SV=1 1 450 2.0E-85
sp|Q9AJC6|LYSDH_GEOSE Lysine 6-dehydrogenase OS=Geobacillus stearothermophilus GN=lysDH PE=1 SV=1 7 266 4.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6401
MAPSQSVLMLGAGFVTRPTLDILTQSGISVTVAIARQASRSRESAKKLCAGINKATPITLDVNDQEALDAEVAKH
DLVISLIPYTFHATIIKSAIRNKKNVVTTSYVSPAMMELDQQCKEAGITVMNEIGLDPGIDHLYAVKTIDEVHKA
GGKILSFLSFCGGLPAPEASDNPLGYKFSWSSRGVLLALRNAAKIYQGGKIVEISSKDLMGTAKPYFIYPGYAFV
AYANRDSTPYKQRYGIPEAQTIIRGTLRYQGFPQFIRVLVDTGFLEETPKEILSKPVTWREATQAIIGAPSASPS
DLEETIVRLATFDSPEDQQRILSGLRWIGIFSEDKIMPRGNPLDTLCATLEQKMQFEAGERDMVLLQHKFEIEHK
DGSRETRTSTLVEYGDPKGYSAMAKLVGVPCAVAVKQVLDGTLSEKGILAPMTAKINAPIMKELKEKYGIELVEK
TVL*
Coding >OphauG2|6401
ATGGCTCCCTCACAGTCCGTATTGATGCTCGGAGCGGGCTTCGTGACGCGTCCCACCCTTGACATTCTGACCCAG
AGTGGTATCTCGGTAACAGTCGCCATTGCTCGCCAAGCTTCGCGAAGCCGCGAGTCTGCCAAAAAGCTCTGTGCG
GGCATCAACAAGGCCACGCCAATTACCCTCGATGTCAACGATCAAGAGGCCCTCGATGCAGAGGTGGCCAAGCAC
GACCTAGTCATTAGTCTAATTCCCTACACCTTCCACGCCACCATCATCAAGTCGGCCATTCGCAACAAGAAGAAT
GTAGTCACAACGAGCTATGTCTCCCCCGCCATGATGGAGCTCGACCAGCAATGCAAGGAGGCCGGCATCACTGTC
ATGAACGAAATTGGCCTTGACCCGGGCATTGACCACCTCTACGCCGTCAAGACGATTGACGAGGTGCACAAGGCC
GGTGGCAAAATCCTGTCCTTCCTCTCCTTTTGCGGAGGCCTGCCTGCCCCCGAGGCTTCGGATAATCCCCTGGGC
TATAAGTTTTCCTGGTCGTCACGCGGTGTCCTACTGGCTCTGCGGAACGCTGCAAAGATTTACCAGGGCGGCAAG
ATTGTCGAAATTTCTTCCAAGGACCTCATGGGCACCGCCAAGCCCTACTTCATTTACCCAGGCTATGCCTTTGTT
GCCTACGCCAATCGCGACTCGACGCCTTACAAGCAGCGGTATGGCATCCCAGAAGCTCAGACCATTATTCGCGGC
ACTCTGAGATACCAAGGATTTCCGCAGTTTATCCGCGTCTTGGTGGATACGGGCTTCCTCGAGGAAACTCCCAAG
GAGATTCTGAGCAAGCCAGTGACGTGGAGAGAGGCGACACAAGCCATTATTGGAGCGCCGTCGGCCTCACCCAGT
GACCTGGAGGAAACCATTGTGCGGCTGGCAACGTTTGATTCTCCCGAGGACCAACAACGCATCCTCAGTGGCCTG
CGCTGGATCGGCATCTTCTCGGAGGACAAGATTATGCCGCGCGGCAACCCGCTCGACACACTCTGCGCCACGCTG
GAGCAGAAGATGCAATTCGAAGCGGGCGAGCGGGACATGGTGCTATTGCAGCACAAGTTTGAAATTGAGCACAAG
GACGGGTCGCGCGAGACGCGCACGTCGACGTTGGTGGAATACGGTGATCCCAAGGGCTACTCAGCCATGGCTAAA
CTGGTGGGTGTGCCGTGTGCCGTGGCCGTCAAGCAGGTGCTGGATGGGACCCTGTCGGAAAAAGGTATTTTGGCC
CCCATGACAGCCAAGATTAACGCGCCCATTATGAAGGAGCTCAAGGAAAAGTACGGTATTGAATTGGTGGAGAAG
ACGGTGCTGTAG
Transcript >OphauG2|6401
ATGGCTCCCTCACAGTCCGTATTGATGCTCGGAGCGGGCTTCGTGACGCGTCCCACCCTTGACATTCTGACCCAG
AGTGGTATCTCGGTAACAGTCGCCATTGCTCGCCAAGCTTCGCGAAGCCGCGAGTCTGCCAAAAAGCTCTGTGCG
GGCATCAACAAGGCCACGCCAATTACCCTCGATGTCAACGATCAAGAGGCCCTCGATGCAGAGGTGGCCAAGCAC
GACCTAGTCATTAGTCTAATTCCCTACACCTTCCACGCCACCATCATCAAGTCGGCCATTCGCAACAAGAAGAAT
GTAGTCACAACGAGCTATGTCTCCCCCGCCATGATGGAGCTCGACCAGCAATGCAAGGAGGCCGGCATCACTGTC
ATGAACGAAATTGGCCTTGACCCGGGCATTGACCACCTCTACGCCGTCAAGACGATTGACGAGGTGCACAAGGCC
GGTGGCAAAATCCTGTCCTTCCTCTCCTTTTGCGGAGGCCTGCCTGCCCCCGAGGCTTCGGATAATCCCCTGGGC
TATAAGTTTTCCTGGTCGTCACGCGGTGTCCTACTGGCTCTGCGGAACGCTGCAAAGATTTACCAGGGCGGCAAG
ATTGTCGAAATTTCTTCCAAGGACCTCATGGGCACCGCCAAGCCCTACTTCATTTACCCAGGCTATGCCTTTGTT
GCCTACGCCAATCGCGACTCGACGCCTTACAAGCAGCGGTATGGCATCCCAGAAGCTCAGACCATTATTCGCGGC
ACTCTGAGATACCAAGGATTTCCGCAGTTTATCCGCGTCTTGGTGGATACGGGCTTCCTCGAGGAAACTCCCAAG
GAGATTCTGAGCAAGCCAGTGACGTGGAGAGAGGCGACACAAGCCATTATTGGAGCGCCGTCGGCCTCACCCAGT
GACCTGGAGGAAACCATTGTGCGGCTGGCAACGTTTGATTCTCCCGAGGACCAACAACGCATCCTCAGTGGCCTG
CGCTGGATCGGCATCTTCTCGGAGGACAAGATTATGCCGCGCGGCAACCCGCTCGACACACTCTGCGCCACGCTG
GAGCAGAAGATGCAATTCGAAGCGGGCGAGCGGGACATGGTGCTATTGCAGCACAAGTTTGAAATTGAGCACAAG
GACGGGTCGCGCGAGACGCGCACGTCGACGTTGGTGGAATACGGTGATCCCAAGGGCTACTCAGCCATGGCTAAA
CTGGTGGGTGTGCCGTGTGCCGTGGCCGTCAAGCAGGTGCTGGATGGGACCCTGTCGGAAAAAGGTATTTTGGCC
CCCATGACAGCCAAGATTAACGCGCCCATTATGAAGGAGCTCAAGGAAAAGTACGGTATTGAATTGGTGGAGAAG
ACGGTGCTGTAG
Gene >OphauG2|6401
ATGGCTCCCTCACAGTAAGGGCCGCATCCCCCCAGACACCTTGCCTGCAATTGGCCCACTCAACTGAGGTCTGCA
GGTCCGTATTGATGCTCGGAGCGGGCTTCGTGACGCGTCCCACCCTTGACATTCTGACCCAGAGTGGTATCTCGG
TAACAGTCGGTGAGTCGCTTCCCCCTCCTCAAGCTTGGCAAAGAGCCATTGCGAGGTCGGAGCTCATAAGCCATT
GCTCGCCAAGCTTCGCGAAGCCGCGAGTCTGCCAAAAAGCTCTGTGCGGGCATCAACAAGGCCACGCCAATTACC
CTCGATGTCAACGATCAAGAGGCCCTCGATGCAGAGGTGGCCAAGCACGACCTAGTCATTAGTCTAATTCCCTAC
ACCTTCCACGCCACCATCATCAAGTCGGCCATTCGCAACAAGAAGAATGTAGTCACAACGAGCTATGTCTCCCCC
GCCATGATGGAGCTCGACCAGCAATGCAAGGAGGCCGGCATCACTGTCATGAACGAAATTGGCCTTGACCCGGGC
ATTGACCACCTCTACGCCGTCAAGACGATTGACGAGGTGCACAAGGCCGGTGGCAAAATCCTGTCCTTCCTCTCC
TTTTGCGGAGGCCTGCCTGCCCCCGAGGCTTCGGATAATCCCCTGGGCTATAAGTTTTCCTGGTCGTCACGCGGT
GTCCTACTGGCTCTGCGGAACGCTGCAAAGATTTACCAGGGCGGCAAGATTGTCGAAATTTCTTCCAAGGACCTC
ATGGGCACCGCCAAGCCCTACTTCATTTACCCAGGCTATGCCTTTGTTGCCTACGCCAATCGCGACTCGACGCCT
TACAAGCAGCGGTATGGCATCCCAGAAGCTCAGACCATTATTCGCGGCACTCTGAGATACCAAGGATTTCCGCAG
TTTATCCGCGTCTTGGTGGATACGGGCTTCCTCGAGGAAACTCCCAAGGAGATTCTGAGCAAGCCAGTGACGTGG
AGAGAGGCGACACAAGCCATTATTGGAGCGCCGTCGGCCTCACCCAGTGACCTGGAGGAAACCATTGTGCGGCTG
GCAACGTTTGATTCTCCCGAGGACCAACAACGCATCCTCAGTGGCCTGCGCTGGATCGGCATCTTCTCGGAGGAC
AAGATTATGCCGCGCGGCAACCCGCTCGACACACTCTGCGCCACGCTGGAGCAGAAGATGCAATTCGAAGCGGGC
GAGCGGGACATGGTGCTATTGCAGCACAAGTTTGAAATTGAGCACAAGGACGGGTCGCGCGAGACGCGCACGTCG
ACGTTGGTGGAATACGGTGATCCCAAGGGCTACTCAGCCATGGCTAAACTGGTGGGTGTGCCGTGTGCCGTGGCC
GTCAAGCAGGTGCTGGATGGGACCCTGTCGGAAAAAGGTATTTTGGCCCCCATGACAGCCAAGATTAACGCGCCC
ATTATGAAGGAGCTCAAGGAAAAGTACGGTATTGAATTGGTGGAGAAGACGGTGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail