Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|6398
Gene name
LocationContig_657:6575..6782
Strand+
Gene length (bp)207
Transcript length (bp)207
Coding sequence length (bp)207
Protein length (aa) 69

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13867 SAP30_Sin3_bdg Sin3 binding region of histone deacetylase complex subunit SAP30 4.3E-08 15 47

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4243
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6398 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1226
Ophiocordyceps camponoti-floridani Ophcf2|02773
Ophiocordyceps camponoti-rufipedis Ophun1|1847
Ophiocordyceps kimflemingae Ophio5|2239
Ophiocordyceps subramaniannii Hirsu2|8669

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|6398
MARASPAARNARSARQSKEQLAMAVRKHFNAMGVQENDVIVDLIYKLRSDAAHSRQKGPKRQPPPLNN*
Coding >OphauG2|6398
ATGGCGCGAGCCTCGCCTGCCGCCAGGAATGCTCGCTCTGCCCGCCAATCCAAAGAACAGCTGGCAATGGCGGTG
CGCAAACACTTCAACGCCATGGGAGTCCAGGAAAATGATGTAATTGTCGATCTCATCTACAAGCTGCGCAGCGAC
GCAGCGCACTCGAGGCAAAAGGGCCCAAAGCGACAGCCGCCTCCCCTCAACAATTGA
Transcript >OphauG2|6398
ATGGCGCGAGCCTCGCCTGCCGCCAGGAATGCTCGCTCTGCCCGCCAATCCAAAGAACAGCTGGCAATGGCGGTG
CGCAAACACTTCAACGCCATGGGAGTCCAGGAAAATGATGTAATTGTCGATCTCATCTACAAGCTGCGCAGCGAC
GCAGCGCACTCGAGGCAAAAGGGCCCAAAGCGACAGCCGCCTCCCCTCAACAATTGA
Gene >OphauG2|6398
ATGGCGCGAGCCTCGCCTGCCGCCAGGAATGCTCGCTCTGCCCGCCAATCCAAAGAACAGCTGGCAATGGCGGTG
CGCAAACACTTCAACGCCATGGGAGTCCAGGAAAATGATGTAATTGTCGATCTCATCTACAAGCTGCGCAGCGAC
GCAGCGCACTCGAGGCAAAAGGGCCCAAAGCGACAGCCGCCTCCCCTCAACAATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail