Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|639
Gene name
LocationContig_116:3767..7847
Strand+
Gene length (bp)4080
Transcript length (bp)4026
Coding sequence length (bp)4026
Protein length (aa) 1342

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12455 Dynactin Dynein associated protein 1.1E-102 624 907
PF01302 CAP_GLY CAP-Gly domain 6.0E-24 7 68

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q01397|DYNA_NEUCR Dynactin, 150 kDa isoform OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ro-3 PE=3 SV=3 7 1335 0.0E+00
sp|P35458|DCTN1_CHICK Dynactin subunit 1 OS=Gallus gallus GN=DCTN1 PE=1 SV=2 198 894 2.0E-63
sp|Q14203|DCTN1_HUMAN Dynactin subunit 1 OS=Homo sapiens GN=DCTN1 PE=1 SV=3 209 894 1.0E-59
sp|O08788|DCTN1_MOUSE Dynactin subunit 1 OS=Mus musculus GN=Dctn1 PE=1 SV=3 209 894 3.0E-59
sp|P28023|DCTN1_RAT Dynactin subunit 1 OS=Rattus norvegicus GN=Dctn1 PE=1 SV=2 209 876 2.0E-58
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q01397|DYNA_NEUCR Dynactin, 150 kDa isoform OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ro-3 PE=3 SV=3 7 1335 0.0E+00
sp|P35458|DCTN1_CHICK Dynactin subunit 1 OS=Gallus gallus GN=DCTN1 PE=1 SV=2 198 894 2.0E-63
sp|Q14203|DCTN1_HUMAN Dynactin subunit 1 OS=Homo sapiens GN=DCTN1 PE=1 SV=3 209 894 1.0E-59
sp|O08788|DCTN1_MOUSE Dynactin subunit 1 OS=Mus musculus GN=Dctn1 PE=1 SV=3 209 894 3.0E-59
sp|P28023|DCTN1_RAT Dynactin subunit 1 OS=Rattus norvegicus GN=Dctn1 PE=1 SV=2 209 876 2.0E-58
sp|Q6PCJ1|DCTN1_XENLA Dynactin subunit 1 OS=Xenopus laevis GN=dctn1 PE=2 SV=1 260 872 3.0E-58
sp|P13496|DCTN1_DROME Dynactin subunit 1 OS=Drosophila melanogaster GN=Gl PE=1 SV=2 159 827 8.0E-43
sp|Q6PCJ1|DCTN1_XENLA Dynactin subunit 1 OS=Xenopus laevis GN=dctn1 PE=2 SV=1 4 123 3.0E-15
sp|Q14203|DCTN1_HUMAN Dynactin subunit 1 OS=Homo sapiens GN=DCTN1 PE=1 SV=3 12 191 4.0E-15
sp|Q922J3|CLIP1_MOUSE CAP-Gly domain-containing linker protein 1 OS=Mus musculus GN=Clip1 PE=1 SV=1 3 169 4.0E-15
sp|P30622|CLIP1_HUMAN CAP-Gly domain-containing linker protein 1 OS=Homo sapiens GN=CLIP1 PE=1 SV=2 3 88 5.0E-15
sp|Q9D1E6|TBCB_MOUSE Tubulin-folding cofactor B OS=Mus musculus GN=Tbcb PE=1 SV=2 16 76 5.0E-15
sp|Q9VJE5|CL190_DROME Restin homolog OS=Drosophila melanogaster GN=CLIP-190 PE=1 SV=1 4 99 7.0E-15
sp|P28023|DCTN1_RAT Dynactin subunit 1 OS=Rattus norvegicus GN=Dctn1 PE=1 SV=2 12 130 8.0E-15
sp|O08788|DCTN1_MOUSE Dynactin subunit 1 OS=Mus musculus GN=Dctn1 PE=1 SV=3 12 130 9.0E-15
sp|P13496|DCTN1_DROME Dynactin subunit 1 OS=Drosophila melanogaster GN=Gl PE=1 SV=2 3 207 9.0E-15
sp|P35458|DCTN1_CHICK Dynactin subunit 1 OS=Gallus gallus GN=DCTN1 PE=1 SV=2 4 212 1.0E-14
sp|O42667|SSM4_SCHPO Microtubule-associated protein ssm4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssm4 PE=1 SV=1 15 102 1.0E-14
sp|O42184|CLIP1_CHICK CAP-Gly domain-containing linker protein 1 OS=Gallus gallus GN=CLIP1 PE=2 SV=1 3 99 1.0E-14
sp|Q9UDT6|CLIP2_HUMAN CAP-Gly domain-containing linker protein 2 OS=Homo sapiens GN=CLIP2 PE=1 SV=1 3 88 3.0E-14
sp|Q922J3|CLIP1_MOUSE CAP-Gly domain-containing linker protein 1 OS=Mus musculus GN=Clip1 PE=1 SV=1 3 76 4.0E-14
sp|Q9Z0H8|CLIP2_MOUSE CAP-Gly domain-containing linker protein 2 OS=Mus musculus GN=Clip2 PE=1 SV=2 3 88 6.0E-14
sp|O55156|CLIP2_RAT CAP-Gly domain-containing linker protein 2 OS=Rattus norvegicus GN=Clip2 PE=1 SV=1 3 88 7.0E-14
sp|Q9UDT6|CLIP2_HUMAN CAP-Gly domain-containing linker protein 2 OS=Homo sapiens GN=CLIP2 PE=1 SV=1 1 171 8.0E-14
sp|Q96DZ5|CLIP3_HUMAN CAP-Gly domain-containing linker protein 3 OS=Homo sapiens GN=CLIP3 PE=1 SV=3 7 87 1.0E-13
sp|B9EHT4|CLIP3_MOUSE CAP-Gly domain-containing linker protein 3 OS=Mus musculus GN=Clip3 PE=1 SV=1 7 87 1.0E-13
sp|Q5R686|CLIP3_PONAB CAP-Gly domain-containing linker protein 3 OS=Pongo abelii GN=CLIP3 PE=2 SV=1 7 87 1.0E-13
sp|Q5U243|CLIP3_XENLA CAP-Gly domain-containing linker protein 3 OS=Xenopus laevis GN=clip3 PE=2 SV=1 4 89 1.0E-13
sp|P30622|CLIP1_HUMAN CAP-Gly domain-containing linker protein 1 OS=Homo sapiens GN=CLIP1 PE=1 SV=2 1 102 1.0E-13
sp|Q99426|TBCB_HUMAN Tubulin-folding cofactor B OS=Homo sapiens GN=TBCB PE=1 SV=2 16 72 2.0E-13
sp|Q5E951|TBCB_BOVIN Tubulin-folding cofactor B OS=Bos taurus GN=TBCB PE=2 SV=1 16 72 4.0E-13
sp|Q9Z0H8|CLIP2_MOUSE CAP-Gly domain-containing linker protein 2 OS=Mus musculus GN=Clip2 PE=1 SV=2 1 127 5.0E-13
sp|O55156|CLIP2_RAT CAP-Gly domain-containing linker protein 2 OS=Rattus norvegicus GN=Clip2 PE=1 SV=1 1 127 1.0E-12
sp|O42184|CLIP1_CHICK CAP-Gly domain-containing linker protein 1 OS=Gallus gallus GN=CLIP1 PE=2 SV=1 1 67 2.0E-12
sp|Q9NQT8|KI13B_HUMAN Kinesin-like protein KIF13B OS=Homo sapiens GN=KIF13B PE=1 SV=2 7 70 2.0E-12
sp|Q20728|TBCB_CAEEL Tubulin-specific chaperone B OS=Caenorhabditis elegans GN=tbcb-1 PE=1 SV=1 9 82 7.0E-12
sp|Q9VJE5|CL190_DROME Restin homolog OS=Drosophila melanogaster GN=CLIP-190 PE=1 SV=1 7 72 9.0E-12
sp|Q8N3C7|CLIP4_HUMAN CAP-Gly domain-containing linker protein 4 OS=Homo sapiens GN=CLIP4 PE=1 SV=1 7 70 1.0E-11
sp|Q66HD5|CLIP4_RAT CAP-Gly domain-containing linker protein 4 OS=Rattus norvegicus GN=Clip4 PE=1 SV=1 7 70 2.0E-11
sp|Q8CI96|CLIP4_MOUSE CAP-Gly domain-containing linker protein 4 OS=Mus musculus GN=Clip4 PE=1 SV=1 7 70 2.0E-11
sp|Q5U243|CLIP3_XENLA CAP-Gly domain-containing linker protein 3 OS=Xenopus laevis GN=clip3 PE=2 SV=1 7 76 4.0E-11
sp|Q5R686|CLIP3_PONAB CAP-Gly domain-containing linker protein 3 OS=Pongo abelii GN=CLIP3 PE=2 SV=1 7 64 5.0E-11
sp|Q96DZ5|CLIP3_HUMAN CAP-Gly domain-containing linker protein 3 OS=Homo sapiens GN=CLIP3 PE=1 SV=3 7 64 5.0E-11
sp|Q54Z01|TBCB_DICDI Tubulin-specific chaperone B OS=Dictyostelium discoideum GN=tbcb PE=3 SV=1 14 76 7.0E-10
sp|B9EHT4|CLIP3_MOUSE CAP-Gly domain-containing linker protein 3 OS=Mus musculus GN=Clip3 PE=1 SV=1 7 64 8.0E-10
sp|Q5VT06|CE350_HUMAN Centrosome-associated protein 350 OS=Homo sapiens GN=CEP350 PE=1 SV=1 3 75 9.0E-10
sp|Q8N3C7|CLIP4_HUMAN CAP-Gly domain-containing linker protein 4 OS=Homo sapiens GN=CLIP4 PE=1 SV=1 8 71 1.0E-09
sp|Q66HD5|CLIP4_RAT CAP-Gly domain-containing linker protein 4 OS=Rattus norvegicus GN=Clip4 PE=1 SV=1 4 64 1.0E-09
sp|Q8CI96|CLIP4_MOUSE CAP-Gly domain-containing linker protein 4 OS=Mus musculus GN=Clip4 PE=1 SV=1 4 64 2.0E-09
sp|Q8N3C7|CLIP4_HUMAN CAP-Gly domain-containing linker protein 4 OS=Homo sapiens GN=CLIP4 PE=1 SV=1 4 64 2.0E-09
sp|Q8CI96|CLIP4_MOUSE CAP-Gly domain-containing linker protein 4 OS=Mus musculus GN=Clip4 PE=1 SV=1 8 71 3.0E-09
sp|P33420|NIP80_YEAST Protein NIP100 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NIP100 PE=1 SV=2 8 66 8.0E-09
sp|Q67Z52|TBCB_ARATH Tubulin-folding cofactor B OS=Arabidopsis thaliana GN=TFCB PE=1 SV=1 3 76 2.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|639
MPDFKPGQTVQLSDGRRGTVRFAGQTHFQVGEWVGVELEEKTGKNDGSVQGQRYFDCPMGYGMFVKPVMVTIVAQ
PPAAVSKPSAPRRPTRPSSFNPGAPRPQMDAASAKRRSLNAPSPSPGPKTSRPASLAGSRSPVKSPTKLLSGPPS
SSASRTGTPSMARVPSAGARSRTSVSGQRTVTSMGPPPAPASRPQRPPSTGTPKAIGVPARTPTGRTTMTGLRTL
ARSDSSRRPSADSQAGRISTSTDGTAPGSPLKSNGDILSPQPTSPGFARASALEKLTAAATPASSAATSNRAAPT
VATSSPRTTASAAAAREIEDLKAKLKILERKRVEDRDKIILLDRVQGERDKLETIIQKLRQKYQPQQEENNELKR
QLKDMQSKVESMEVSQADIDTVLELATLDREMAEETAENLKWELDNLKQRFEEAELELDILREENAEYSNGMTPE
ERASTGWLQMERTNERLREALLRLRDMTQAQEEELHHQVSGLEDEVKEFAKLKEEHEGIQEKLTSSELAVDHLRQ
QLDNALGAEDMIEQLTEQNMAISEKVEKLKTTIEELEELKELGDELEANHETNERQLQELLDDRESSMAEKDRQA
AQLVEALEDKEYQLSRFRQLVTTMQGDLEDMRASQAVTEGESEKLNDSSRAMMDLNMKLQISASKAQVKTIDLEL
RRLEAQEAEQHLEIVKLFLPDSYQEDQDSVLSLLRFRRLAFKADLLNGFIRERINGQTHAGHEDDIMAGCDAADQ
LVWVSCMCECFANDISHCPMEQFSKYQEALLELEPVERALNSWIDGLRKDDLKEKKCAEELHRTVSLLSHLAEMH
LSSSLSNYAQEVHMKSLVTQSHLETAAVALNTSRTMVERALLSDDQAADVAATAQHLMNKLDQGISQTRSTKMVA
AKAVRALQDLKTRSLSLSPASREVFEQTEADSQVLAHAARSIGNAIHGLLTQDEGRTEPWAAAEIEKVIHESVLE
TLSADESDTLSTYLAKLRAVNEQVSDLTVLATDLDQTQEFDVLPAPWRLRSQELKTLKTVPVDAEEELRRVKEEH
SEARRTIAQRDEHLSTAMLKIETLEARMRDAKANIDHISKLEKQLESSGEQMTSLKDDIEKQDRELKNLELERDK
WKKIASDSRAYADGADAAGLKAGQERAVATAREMDMLNREIESLQLAVRYLRQDNRRARGEEQHMYEWLAEPLKR
PASLDQERKQLVVAETKDVLGELVKMASSASLFNYASLPQDKLAWRPAKATPQYHTARQMEDYAAWHAWERSVLT
KSAALSKADDGKRRRWARKPAARLQIRLPTSGADGADKPLVAMGGDVEVVGSREWEALQGMRVDAV*
Coding >OphauG2|639
ATGCCAGACTTCAAGCCCGGCCAGACGGTGCAGCTCAGCGATGGCCGTCGCGGCACCGTCCGCTTCGCCGGCCAG
ACGCACTTCCAGGTCGGCGAGTGGGTTGGCGTCGAGCTCGAGGAGAAGACAGGCAAAAACGATGGCAGCGTCCAG
GGCCAGCGCTACTTTGACTGTCCAATGGGCTACGGCATGTTTGTCAAGCCCGTCATGGTGACCATTGTCGCCCAG
CCGCCAGCCGCCGTCTCCAAGCCCTCGGCCCCTCGCCGCCCTACCAGACCCAGCAGCTTCAACCCCGGAGCTCCT
CGTCCGCAGATGGATGCCGCCTCGGCCAAGCGAAGGAGCCTCAATGCCCCCAGCCCGAGCCCGGGGCCCAAGACG
TCGCGTCCAGCCAGTCTGGCCGGCTCAAGGTCTCCCGTCAAATCTCCCACCAAACTTTTGAGCGGTCCCCCGAGC
TCATCGGCTTCTCGAACCGGCACCCCGTCCATGGCCCGCGTGCCCTCTGCTGGAGCCCGATCTCGCACCTCGGTC
AGCGGACAGAGGACAGTAACTTCCATGGGTCCTCCTCCTGCCCCCGCATCCCGACCCCAGAGGCCTCCCTCGACT
GGCACTCCCAAGGCTATTGGCGTTCCTGCCCGAACCCCCACTGGACGTACAACAATGACGGGCCTACGCACTCTT
GCACGCTCCGACTCGTCGCGGCGGCCCTCTGCCGACTCACAAGCCGGACGCATCAGCACTTCGACGGATGGCACA
GCACCTGGCTCCCCATTGAAAAGCAATGGTGACATCTTGTCGCCCCAGCCCACAAGCCCGGGGTTTGCACGAGCA
AGTGCGCTGGAGAAACTCACCGCCGCTGCCACCCCAGCGTCTTCTGCCGCCACATCCAACCGAGCAGCCCCGACT
GTAGCTACTTCATCGCCACGCACCACGGCCAGCGCAGCCGCAGCACGAGAAATAGAAGACCTCAAGGCCAAACTC
AAAATTCTGGAGCGGAAACGAGTCGAAGACCGAGACAAGATTATCTTGCTAGACCGAGTACAAGGGGAGCGCGAC
AAGCTTGAAACCATTATTCAAAAACTCCGACAAAAGTATCAGCCTCAACAGGAGGAAAACAATGAGTTGAAAAGG
CAGCTCAAAGACATGCAGTCCAAGGTGGAGTCGATGGAAGTCTCACAGGCAGATATCGACACAGTCCTTGAACTC
GCCACTCTGGACCGCGAAATGGCAGAGGAGACTGCAGAAAATCTCAAATGGGAACTCGACAACCTCAAACAAAGG
TTCGAAGAGGCGGAGCTGGAACTAGACATTTTGCGGGAAGAAAACGCCGAGTACAGCAATGGTATGACGCCAGAA
GAGCGTGCCAGTACCGGCTGGTTACAAATGGAGCGTACCAATGAGCGACTTCGTGAAGCACTGCTGCGACTACGA
GACATGACCCAGGCCCAAGAGGAGGAGTTGCATCATCAGGTCTCGGGCCTGGAGGATGAAGTCAAGGAGTTTGCA
AAGCTAAAGGAGGAGCACGAGGGCATACAGGAAAAGCTGACAAGCTCAGAGTTGGCTGTGGACCACCTCCGTCAG
CAGCTGGACAACGCTCTGGGCGCTGAGGACATGATTGAACAGCTGACGGAACAAAACATGGCAATATCGGAAAAG
GTCGAGAAGCTCAAGACGACGATTGAAGAGCTTGAGGAGCTCAAGGAGCTAGGCGACGAGCTCGAAGCCAATCAC
GAGACCAACGAGAGGCAGCTCCAAGAGCTGCTTGACGATAGAGAAAGCTCCATGGCAGAAAAGGACCGTCAAGCT
GCACAGCTGGTGGAGGCGCTCGAGGATAAGGAGTACCAGCTGTCTCGCTTCCGCCAGCTTGTCACGACGATGCAG
GGCGATTTGGAAGACATGCGCGCCTCGCAAGCCGTCACCGAGGGCGAGTCGGAGAAACTCAACGACAGCTCACGA
GCCATGATGGACCTCAATATGAAGCTGCAAATCTCGGCCAGCAAGGCGCAGGTCAAGACTATTGACCTGGAGCTG
CGCCGGCTGGAAGCCCAGGAAGCAGAACAGCATCTCGAAATCGTCAAGTTGTTCCTGCCCGACAGCTACCAGGAG
GACCAAGACTCGGTGCTTTCTCTGCTGCGCTTCCGGAGACTGGCCTTCAAGGCCGACCTGCTCAACGGCTTCATC
CGCGAACGCATCAATGGCCAGACGCATGCGGGCCACGAAGACGACATCATGGCTGGATGTGACGCTGCCGACCAG
CTTGTATGGGTGTCTTGCATGTGCGAATGCTTTGCCAACGACATTAGCCACTGCCCCATGGAGCAGTTCTCCAAG
TATCAAGAAGCCTTGCTCGAGCTGGAGCCGGTGGAGCGGGCCTTGAACTCGTGGATTGACGGGCTGCGCAAAGAC
GACCTCAAGGAAAAGAAGTGCGCCGAGGAGCTACATCGCACCGTCTCGCTGCTGTCTCATCTGGCGGAGATGCAC
CTGTCGAGCAGCCTCAGCAACTACGCCCAAGAGGTGCACATGAAGTCGCTGGTGACGCAGAGCCATCTCGAGACG
GCAGCTGTTGCACTCAACACGTCGCGCACCATGGTTGAGCGCGCTCTCCTTTCCGACGACCAGGCGGCTGACGTG
GCGGCCACGGCCCAGCATTTGATGAACAAGCTGGATCAGGGCATTTCGCAGACGAGGAGCACCAAAATGGTGGCG
GCAAAGGCGGTGCGGGCCCTGCAAGATCTCAAGACGCGCTCGCTGTCTCTGTCGCCAGCCTCACGAGAGGTGTTT
GAGCAGACCGAGGCTGACAGCCAAGTCTTGGCCCATGCGGCGCGCAGCATTGGCAACGCCATTCACGGGCTCTTG
ACGCAAGACGAAGGACGCACTGAGCCGTGGGCTGCGGCTGAGATTGAAAAGGTGATTCATGAGTCAGTTTTGGAG
ACACTTTCGGCGGATGAGTCGGATACGCTGTCGACATATCTGGCCAAGCTCCGGGCCGTCAACGAGCAGGTGTCT
GATTTGACTGTGCTGGCCACAGACTTGGATCAGACACAGGAGTTTGACGTGCTTCCTGCACCCTGGCGGCTGCGA
AGCCAGGAGCTCAAGACGCTCAAGACGGTGCCCGTGGATGCAGAGGAGGAGTTGCGACGGGTCAAGGAGGAGCAC
AGCGAGGCCCGGCGCACCATTGCACAGCGCGACGAACACCTCAGTACCGCCATGCTCAAGATTGAGACGCTCGAA
GCGCGCATGCGAGATGCGAAAGCTAACATTGATCACATCTCCAAGCTCGAGAAGCAGCTCGAGTCTTCGGGGGAG
CAGATGACGAGCCTCAAGGACGACATTGAAAAGCAAGACCGAGAGCTCAAGAACCTCGAGCTAGAGCGCGACAAG
TGGAAGAAGATTGCCAGCGATAGCAGGGCGTATGCTGACGGAGCCGACGCTGCTGGCCTTAAGGCGGGCCAGGAG
CGCGCCGTTGCTACTGCTCGCGAGATGGACATGCTGAATAGAGAGATTGAGAGCCTGCAATTGGCGGTGCGCTAC
CTGCGTCAAGACAACCGCCGAGCTCGCGGCGAGGAGCAGCACATGTACGAGTGGCTGGCGGAGCCGCTCAAGAGA
CCGGCCAGTCTTGACCAGGAGCGCAAACAGCTCGTCGTGGCTGAGACCAAGGACGTGCTCGGAGAGCTGGTCAAG
ATGGCCTCGTCGGCCAGCCTCTTCAACTATGCCTCATTGCCGCAGGACAAGCTGGCATGGCGGCCGGCCAAGGCG
ACGCCGCAGTACCACACGGCCAGGCAGATGGAGGACTATGCCGCCTGGCACGCCTGGGAGCGGTCCGTCTTGACC
AAGTCGGCCGCTCTGTCCAAGGCTGACGACGGCAAAAGACGGCGTTGGGCACGAAAGCCTGCGGCGCGGCTTCAA
ATTAGACTGCCCACAAGCGGTGCCGACGGCGCCGACAAGCCCTTGGTGGCTATGGGCGGTGATGTTGAAGTGGTG
GGCTCGCGCGAGTGGGAGGCGCTTCAAGGGATGCGGGTGGATGCTGTGTAG
Transcript >OphauG2|639
ATGCCAGACTTCAAGCCCGGCCAGACGGTGCAGCTCAGCGATGGCCGTCGCGGCACCGTCCGCTTCGCCGGCCAG
ACGCACTTCCAGGTCGGCGAGTGGGTTGGCGTCGAGCTCGAGGAGAAGACAGGCAAAAACGATGGCAGCGTCCAG
GGCCAGCGCTACTTTGACTGTCCAATGGGCTACGGCATGTTTGTCAAGCCCGTCATGGTGACCATTGTCGCCCAG
CCGCCAGCCGCCGTCTCCAAGCCCTCGGCCCCTCGCCGCCCTACCAGACCCAGCAGCTTCAACCCCGGAGCTCCT
CGTCCGCAGATGGATGCCGCCTCGGCCAAGCGAAGGAGCCTCAATGCCCCCAGCCCGAGCCCGGGGCCCAAGACG
TCGCGTCCAGCCAGTCTGGCCGGCTCAAGGTCTCCCGTCAAATCTCCCACCAAACTTTTGAGCGGTCCCCCGAGC
TCATCGGCTTCTCGAACCGGCACCCCGTCCATGGCCCGCGTGCCCTCTGCTGGAGCCCGATCTCGCACCTCGGTC
AGCGGACAGAGGACAGTAACTTCCATGGGTCCTCCTCCTGCCCCCGCATCCCGACCCCAGAGGCCTCCCTCGACT
GGCACTCCCAAGGCTATTGGCGTTCCTGCCCGAACCCCCACTGGACGTACAACAATGACGGGCCTACGCACTCTT
GCACGCTCCGACTCGTCGCGGCGGCCCTCTGCCGACTCACAAGCCGGACGCATCAGCACTTCGACGGATGGCACA
GCACCTGGCTCCCCATTGAAAAGCAATGGTGACATCTTGTCGCCCCAGCCCACAAGCCCGGGGTTTGCACGAGCA
AGTGCGCTGGAGAAACTCACCGCCGCTGCCACCCCAGCGTCTTCTGCCGCCACATCCAACCGAGCAGCCCCGACT
GTAGCTACTTCATCGCCACGCACCACGGCCAGCGCAGCCGCAGCACGAGAAATAGAAGACCTCAAGGCCAAACTC
AAAATTCTGGAGCGGAAACGAGTCGAAGACCGAGACAAGATTATCTTGCTAGACCGAGTACAAGGGGAGCGCGAC
AAGCTTGAAACCATTATTCAAAAACTCCGACAAAAGTATCAGCCTCAACAGGAGGAAAACAATGAGTTGAAAAGG
CAGCTCAAAGACATGCAGTCCAAGGTGGAGTCGATGGAAGTCTCACAGGCAGATATCGACACAGTCCTTGAACTC
GCCACTCTGGACCGCGAAATGGCAGAGGAGACTGCAGAAAATCTCAAATGGGAACTCGACAACCTCAAACAAAGG
TTCGAAGAGGCGGAGCTGGAACTAGACATTTTGCGGGAAGAAAACGCCGAGTACAGCAATGGTATGACGCCAGAA
GAGCGTGCCAGTACCGGCTGGTTACAAATGGAGCGTACCAATGAGCGACTTCGTGAAGCACTGCTGCGACTACGA
GACATGACCCAGGCCCAAGAGGAGGAGTTGCATCATCAGGTCTCGGGCCTGGAGGATGAAGTCAAGGAGTTTGCA
AAGCTAAAGGAGGAGCACGAGGGCATACAGGAAAAGCTGACAAGCTCAGAGTTGGCTGTGGACCACCTCCGTCAG
CAGCTGGACAACGCTCTGGGCGCTGAGGACATGATTGAACAGCTGACGGAACAAAACATGGCAATATCGGAAAAG
GTCGAGAAGCTCAAGACGACGATTGAAGAGCTTGAGGAGCTCAAGGAGCTAGGCGACGAGCTCGAAGCCAATCAC
GAGACCAACGAGAGGCAGCTCCAAGAGCTGCTTGACGATAGAGAAAGCTCCATGGCAGAAAAGGACCGTCAAGCT
GCACAGCTGGTGGAGGCGCTCGAGGATAAGGAGTACCAGCTGTCTCGCTTCCGCCAGCTTGTCACGACGATGCAG
GGCGATTTGGAAGACATGCGCGCCTCGCAAGCCGTCACCGAGGGCGAGTCGGAGAAACTCAACGACAGCTCACGA
GCCATGATGGACCTCAATATGAAGCTGCAAATCTCGGCCAGCAAGGCGCAGGTCAAGACTATTGACCTGGAGCTG
CGCCGGCTGGAAGCCCAGGAAGCAGAACAGCATCTCGAAATCGTCAAGTTGTTCCTGCCCGACAGCTACCAGGAG
GACCAAGACTCGGTGCTTTCTCTGCTGCGCTTCCGGAGACTGGCCTTCAAGGCCGACCTGCTCAACGGCTTCATC
CGCGAACGCATCAATGGCCAGACGCATGCGGGCCACGAAGACGACATCATGGCTGGATGTGACGCTGCCGACCAG
CTTGTATGGGTGTCTTGCATGTGCGAATGCTTTGCCAACGACATTAGCCACTGCCCCATGGAGCAGTTCTCCAAG
TATCAAGAAGCCTTGCTCGAGCTGGAGCCGGTGGAGCGGGCCTTGAACTCGTGGATTGACGGGCTGCGCAAAGAC
GACCTCAAGGAAAAGAAGTGCGCCGAGGAGCTACATCGCACCGTCTCGCTGCTGTCTCATCTGGCGGAGATGCAC
CTGTCGAGCAGCCTCAGCAACTACGCCCAAGAGGTGCACATGAAGTCGCTGGTGACGCAGAGCCATCTCGAGACG
GCAGCTGTTGCACTCAACACGTCGCGCACCATGGTTGAGCGCGCTCTCCTTTCCGACGACCAGGCGGCTGACGTG
GCGGCCACGGCCCAGCATTTGATGAACAAGCTGGATCAGGGCATTTCGCAGACGAGGAGCACCAAAATGGTGGCG
GCAAAGGCGGTGCGGGCCCTGCAAGATCTCAAGACGCGCTCGCTGTCTCTGTCGCCAGCCTCACGAGAGGTGTTT
GAGCAGACCGAGGCTGACAGCCAAGTCTTGGCCCATGCGGCGCGCAGCATTGGCAACGCCATTCACGGGCTCTTG
ACGCAAGACGAAGGACGCACTGAGCCGTGGGCTGCGGCTGAGATTGAAAAGGTGATTCATGAGTCAGTTTTGGAG
ACACTTTCGGCGGATGAGTCGGATACGCTGTCGACATATCTGGCCAAGCTCCGGGCCGTCAACGAGCAGGTGTCT
GATTTGACTGTGCTGGCCACAGACTTGGATCAGACACAGGAGTTTGACGTGCTTCCTGCACCCTGGCGGCTGCGA
AGCCAGGAGCTCAAGACGCTCAAGACGGTGCCCGTGGATGCAGAGGAGGAGTTGCGACGGGTCAAGGAGGAGCAC
AGCGAGGCCCGGCGCACCATTGCACAGCGCGACGAACACCTCAGTACCGCCATGCTCAAGATTGAGACGCTCGAA
GCGCGCATGCGAGATGCGAAAGCTAACATTGATCACATCTCCAAGCTCGAGAAGCAGCTCGAGTCTTCGGGGGAG
CAGATGACGAGCCTCAAGGACGACATTGAAAAGCAAGACCGAGAGCTCAAGAACCTCGAGCTAGAGCGCGACAAG
TGGAAGAAGATTGCCAGCGATAGCAGGGCGTATGCTGACGGAGCCGACGCTGCTGGCCTTAAGGCGGGCCAGGAG
CGCGCCGTTGCTACTGCTCGCGAGATGGACATGCTGAATAGAGAGATTGAGAGCCTGCAATTGGCGGTGCGCTAC
CTGCGTCAAGACAACCGCCGAGCTCGCGGCGAGGAGCAGCACATGTACGAGTGGCTGGCGGAGCCGCTCAAGAGA
CCGGCCAGTCTTGACCAGGAGCGCAAACAGCTCGTCGTGGCTGAGACCAAGGACGTGCTCGGAGAGCTGGTCAAG
ATGGCCTCGTCGGCCAGCCTCTTCAACTATGCCTCATTGCCGCAGGACAAGCTGGCATGGCGGCCGGCCAAGGCG
ACGCCGCAGTACCACACGGCCAGGCAGATGGAGGACTATGCCGCCTGGCACGCCTGGGAGCGGTCCGTCTTGACC
AAGTCGGCCGCTCTGTCCAAGGCTGACGACGGCAAAAGACGGCGTTGGGCACGAAAGCCTGCGGCGCGGCTTCAA
ATTAGACTGCCCACAAGCGGTGCCGACGGCGCCGACAAGCCCTTGGTGGCTATGGGCGGTGATGTTGAAGTGGTG
GGCTCGCGCGAGTGGGAGGCGCTTCAAGGGATGCGGGTGGATGCTGTGTAG
Gene >OphauG2|639
ATGCCAGACTTCAAGCCCGGCCAGACGGTGCAGCTCAGCGATGGCCGTCGCGGCACCGTCCGCTTCGCCGGCCAG
ACGCACTTCCAGGTCGGCGAGTGGGTTGGCGTCGAGCTCGAGGAGAAGACAGGCAAAAACGATGGCAGCGTCCAG
GGCCAGCGCTACTTTGACTGTCCAATGGGCTACGGCATGTTTGTCAAGCCCGTCATGGTGACCATTGTCGCCCAG
CCGCCAGCCGCCGTCTCCAAGCCCTCGGCCCCTCGCCGCCCTACCAGACCCAGCAGCTTCAACCCCGGAGCTCCT
CGTCCGCAGATGGATGCCGCCTCGGCCAAGCGAAGGAGCCTCAATGCCCCCAGCCCGAGCCCGGGGCCCAAGACG
TCGCGTCCAGCCAGTCTGGCCGGCTCAAGGGTCAGCATGTCCAACTCATGCCCATTCTCCCCTTGCTGACAAGAC
ACGCTGTAGTCTCCCGTCAAATCTCCCACCAAACTTTTGAGCGGTCCCCCGAGCTCATCGGCTTCTCGAACCGGC
ACCCCGTCCATGGCCCGCGTGCCCTCTGCTGGAGCCCGATCTCGCACCTCGGTCAGCGGACAGAGGACAGTAACT
TCCATGGGTCCTCCTCCTGCCCCCGCATCCCGACCCCAGAGGCCTCCCTCGACTGGCACTCCCAAGGCTATTGGC
GTTCCTGCCCGAACCCCCACTGGACGTACAACAATGACGGGCCTACGCACTCTTGCACGCTCCGACTCGTCGCGG
CGGCCCTCTGCCGACTCACAAGCCGGACGCATCAGCACTTCGACGGATGGCACAGCACCTGGCTCCCCATTGAAA
AGCAATGGTGACATCTTGTCGCCCCAGCCCACAAGCCCGGGGTTTGCACGAGCAAGTGCGCTGGAGAAACTCACC
GCCGCTGCCACCCCAGCGTCTTCTGCCGCCACATCCAACCGAGCAGCCCCGACTGTAGCTACTTCATCGCCACGC
ACCACGGCCAGCGCAGCCGCAGCACGAGAAATAGAAGACCTCAAGGCCAAACTCAAAATTCTGGAGCGGAAACGA
GTCGAAGACCGAGACAAGATTATCTTGCTAGACCGAGTACAAGGGGAGCGCGACAAGCTTGAAACCATTATTCAA
AAACTCCGACAAAAGTATCAGCCTCAACAGGAGGAAAACAATGAGTTGAAAAGGCAGCTCAAAGACATGCAGTCC
AAGGTGGAGTCGATGGAAGTCTCACAGGCAGATATCGACACAGTCCTTGAACTCGCCACTCTGGACCGCGAAATG
GCAGAGGAGACTGCAGAAAATCTCAAATGGGAACTCGACAACCTCAAACAAAGGTTCGAAGAGGCGGAGCTGGAA
CTAGACATTTTGCGGGAAGAAAACGCCGAGTACAGCAATGGTATGACGCCAGAAGAGCGTGCCAGTACCGGCTGG
TTACAAATGGAGCGTACCAATGAGCGACTTCGTGAAGCACTGCTGCGACTACGAGACATGACCCAGGCCCAAGAG
GAGGAGTTGCATCATCAGGTCTCGGGCCTGGAGGATGAAGTCAAGGAGTTTGCAAAGCTAAAGGAGGAGCACGAG
GGCATACAGGAAAAGCTGACAAGCTCAGAGTTGGCTGTGGACCACCTCCGTCAGCAGCTGGACAACGCTCTGGGC
GCTGAGGACATGATTGAACAGCTGACGGAACAAAACATGGCAATATCGGAAAAGGTCGAGAAGCTCAAGACGACG
ATTGAAGAGCTTGAGGAGCTCAAGGAGCTAGGCGACGAGCTCGAAGCCAATCACGAGACCAACGAGAGGCAGCTC
CAAGAGCTGCTTGACGATAGAGAAAGCTCCATGGCAGAAAAGGACCGTCAAGCTGCACAGCTGGTGGAGGCGCTC
GAGGATAAGGAGTACCAGCTGTCTCGCTTCCGCCAGCTTGTCACGACGATGCAGGGCGATTTGGAAGACATGCGC
GCCTCGCAAGCCGTCACCGAGGGCGAGTCGGAGAAACTCAACGACAGCTCACGAGCCATGATGGACCTCAATATG
AAGCTGCAAATCTCGGCCAGCAAGGCGCAGGTCAAGACTATTGACCTGGAGCTGCGCCGGCTGGAAGCCCAGGAA
GCAGAACAGCATCTCGAAATCGTCAAGTTGTTCCTGCCCGACAGCTACCAGGAGGACCAAGACTCGGTGCTTTCT
CTGCTGCGCTTCCGGAGACTGGCCTTCAAGGCCGACCTGCTCAACGGCTTCATCCGCGAACGCATCAATGGCCAG
ACGCATGCGGGCCACGAAGACGACATCATGGCTGGATGTGACGCTGCCGACCAGCTTGTATGGGTGTCTTGCATG
TGCGAATGCTTTGCCAACGACATTAGCCACTGCCCCATGGAGCAGTTCTCCAAGTATCAAGAAGCCTTGCTCGAG
CTGGAGCCGGTGGAGCGGGCCTTGAACTCGTGGATTGACGGGCTGCGCAAAGACGACCTCAAGGAAAAGAAGTGC
GCCGAGGAGCTACATCGCACCGTCTCGCTGCTGTCTCATCTGGCGGAGATGCACCTGTCGAGCAGCCTCAGCAAC
TACGCCCAAGAGGTGCACATGAAGTCGCTGGTGACGCAGAGCCATCTCGAGACGGCAGCTGTTGCACTCAACACG
TCGCGCACCATGGTTGAGCGCGCTCTCCTTTCCGACGACCAGGCGGCTGACGTGGCGGCCACGGCCCAGCATTTG
ATGAACAAGCTGGATCAGGGCATTTCGCAGACGAGGAGCACCAAAATGGTGGCGGCAAAGGCGGTGCGGGCCCTG
CAAGATCTCAAGACGCGCTCGCTGTCTCTGTCGCCAGCCTCACGAGAGGTGTTTGAGCAGACCGAGGCTGACAGC
CAAGTCTTGGCCCATGCGGCGCGCAGCATTGGCAACGCCATTCACGGGCTCTTGACGCAAGACGAAGGACGCACT
GAGCCGTGGGCTGCGGCTGAGATTGAAAAGGTGATTCATGAGTCAGTTTTGGAGACACTTTCGGCGGATGAGTCG
GATACGCTGTCGACATATCTGGCCAAGCTCCGGGCCGTCAACGAGCAGGTGTCTGATTTGACTGTGCTGGCCACA
GACTTGGATCAGACACAGGAGTTTGACGTGCTTCCTGCACCCTGGCGGCTGCGAAGCCAGGAGCTCAAGACGCTC
AAGACGGTGCCCGTGGATGCAGAGGAGGAGTTGCGACGGGTCAAGGAGGAGCACAGCGAGGCCCGGCGCACCATT
GCACAGCGCGACGAACACCTCAGTACCGCCATGCTCAAGATTGAGACGCTCGAAGCGCGCATGCGAGATGCGAAA
GCTAACATTGATCACATCTCCAAGCTCGAGAAGCAGCTCGAGTCTTCGGGGGAGCAGATGACGAGCCTCAAGGAC
GACATTGAAAAGCAAGACCGAGAGCTCAAGAACCTCGAGCTAGAGCGCGACAAGTGGAAGAAGATTGCCAGCGAT
AGCAGGGCGTATGCTGACGGAGCCGACGCTGCTGGCCTTAAGGCGGGCCAGGAGCGCGCCGTTGCTACTGCTCGC
GAGATGGACATGCTGAATAGAGAGATTGAGAGCCTGCAATTGGCGGTGCGCTACCTGCGTCAAGACAACCGCCGA
GCTCGCGGCGAGGAGCAGCACATGTACGAGTGGCTGGCGGAGCCGCTCAAGAGACCGGCCAGTCTTGACCAGGAG
CGCAAACAGCTCGTCGTGGCTGAGACCAAGGACGTGCTCGGAGAGCTGGTCAAGATGGCCTCGTCGGCCAGCCTC
TTCAACTATGCCTCATTGCCGCAGGACAAGCTGGCATGGCGGCCGGCCAAGGCGACGCCGCAGTACCACACGGCC
AGGCAGATGGAGGACTATGCCGCCTGGCACGCCTGGGAGCGGTCCGTCTTGACCAAGTCGGCCGCTCTGTCCAAG
GCTGACGACGGCAAAAGACGGCGTTGGGCACGAAAGCCTGCGGCGCGGCTTCAAATTAGACTGCCCACAAGCGGT
GCCGACGGCGCCGACAAGCCCTTGGTGGCTATGGGCGGTGATGTTGAAGTGGTGGGCTCGCGCGAGTGGGAGGCG
CTTCAAGGGATGCGGGTGGATGCTGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail